Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.41
PubTator Score 5.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 9.4e-55

Protein-protein Interaction (5)

Gene RIF (3)

PMID Text
23072861 CD300 molecules are all expressed by DC; CD300b, d, e and f are restricted to different subpopulations of the myeloid DC lineage. They have been shown to regulate DC function both in vitro and in vivo.
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15557162 IREM-2 is a novel activating immunoglobulin-like receptor expressed on mature hemopoietic cells of the monocytic and myeloid dendritic cell lineages.

AA Sequence

MWLLPALLLLCLSGCLSLKGPGSVTGTAGDSLTVWCQYESMYKGYNKYWCRGQYDTSCESIVETKGEEKV      1 - 70
ERNGRVSIRDHPEALAFTVTMQNLNEDDAGSYWCKIQTVWVLDSWSRDPSDLVRVYVSPAITTPRRTTHP     71 - 140
ATPPIFLVVNPGRNLSTGEVLTQNSGFRLSSPHFLLVVLLKLPLLLSMLGAVFWVNRPQWAPPGR         141 - 205
//

Text Mined References (15)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23072861 2013 CD300 molecule regulation of human dendritic cell functions.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
20039296 2010 Functional analysis of the CD300e receptor in human monocytes and myeloid dendritic cells.
19592130 2009 The CD300 molecules regulate monocyte and dendritic cell functions.
19359216 2009 The CD300 family of molecules are evolutionarily significant regulators of leukocyte functions.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16920917 2006 Molecular and functional characterization of CD300b, a new activating immunoglobulin receptor able to transduce signals through two different pathways.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15557162 2004 Molecular characterization of a novel immune receptor restricted to the monocytic lineage.
15549731 2004 IREM-1 is a novel inhibitory receptor expressed by myeloid cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12483297 2003 Novel immunoglobulin superfamily gene cluster, mapping to a region of human chromosome 17q25, linked to psoriasis susceptibility.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.