Property Summary

NCBI Gene PubMed Count 30
PubMed Score 82.08
PubTator Score 29.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.233 6.9e-07
diabetes mellitus -1.200 1.8e-03
ovarian cancer 1.500 3.3e-05

Gene RIF (4)

PMID Text
17906334 findings indicate that CD2BP2 is not a constitutive binding partner or key regulator of CD2-mediated signaling events
15840814 interaction of CD2BP2 with a tri-snRNP bridging protein (Prp6), coupled with CD2BP2's absence from the tri-snRNP, suggests it might function in tri-snRNP assembly
15105431 there is a function of the GYF domain of CD2BP2 in mediating protein-protein interactions within the spliceosome
12426371 CD2BP2 is the ligand of the membrane-proximal proline-rich tandem repeat of CD2 in detergent-soluble membrane compartments.

AA Sequence

MPKRKVTFQGVGDEEDEDEIIVPKKKLVDPVAGSGGPGSRFKGKHSLDSDEEEDDDDGGSSKYDILASED      1 - 70
VEGQEAATLPSEGGVRITPFNLQEEMEEGHFDADGNYFLNRDAQIRDSWLDNIDWVKIRERPPGQRQASD     71 - 140
SEEEDSLGQTSMSAQALLEGLLELLLPRETVAGALRRLGARGGGKGRKGPGQPSSPQRLDRLSGLADQMV    141 - 210
ARGNLGVYQETRERLAMRLKGLGCQTLGPHNPTPPPSLDMFAEELAEEELETPTPTQRGEAESRGDGLVD    211 - 280
VMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT             281 - 341
//

Text Mined References (42)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
24781215 2014 Mutations in the PQBP1 gene prevent its interaction with the spliceosomal protein U5-15 kD.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
17906334 2007 Investigating the functional role of CD2BP2 in T cells.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17467737 2007 Structural basis for the bifunctionality of the U5 snRNP 52K protein (CD2BP2).
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16949628 2006 Identification of novel proteins induced by estradiol, 4-hydroxytamoxifen and acolbifene in T47D breast cancer cells.
16941565 Analysis of the CD2 and spliceosomal Sm B/B' polyproline-arginine motifs defined by a monoclonal antibody using a phage-displayed random peptide library.
16723661 2006 The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16403013 2006 The GYF domain.
16120600 2005 GYF domain proteomics reveals interaction sites in known and novel target proteins.
16000308 2005 Novel interaction partners of the CD2BP2-GYF domain.
15850374 2005 Alternative binding modes of proline-rich peptides binding to the GYF domain.
15840814 2005 The human U5 snRNP 52K protein (CD2BP2) interacts with U5-102K (hPrp6), a U4/U6.U5 tri-snRNP bridging protein, but dissociates upon tri-snRNP formation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15105431 2004 Recognition sequences for the GYF domain reveal a possible spliceosomal function of CD2BP2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426371 2002 Dynamic interaction of CD2 with the GYF and the SH3 domain of compartmentalized effector molecules.
12226669 2002 Comprehensive proteomic analysis of the human spliceosome.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
10404223 1999 The GYF domain is a novel structural fold that is involved in lymphoid signaling through proline-rich sequences.
9843987 1998 Identification of a proline-binding motif regulating CD2-triggered T lymphocyte activation.
9741631 1998 A novel adaptor protein orchestrates receptor patterning and cytoskeletal polarity in T-cell contacts.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2527369 1989 20S small nuclear ribonucleoprotein U5 shows a surprisingly complex protein composition.
1831175 1991 Immunoaffinity purification of a [U4/U6.U5] tri-snRNP from human cells.