Property Summary

NCBI Gene PubMed Count 298
PubMed Score 108.85
PubTator Score 1843.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus 2.800 9.3e-04
interstitial cystitis 1.800 3.6e-03
lung cancer -1.100 5.5e-03
non primary Sjogren syndrome sicca -1.200 2.5e-02
osteosarcoma -1.966 8.7e-04
ovarian cancer -2.300 4.5e-12
psoriasis 1.700 9.3e-66
sarcoidosis -1.300 2.3e-05

Protein-protein Interaction (9)

Gene RIF (299)

AA Sequence

MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYG      1 - 70
NYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHL     71 - 140
CPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYA    141 - 210
PPRDFAAYRS                                                                211 - 220
//

Text Mined References (304)

PMID Year Title