Property Summary

Ligand Count 9
NCBI Gene PubMed Count 662
PubMed Score 3285.32
PubTator Score 912.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.579 1.9e-03
active ulcerative colitis 1.021 1.5e-02
Atopic dermatitis 1.400 5.9e-04
Breast cancer 1.300 4.6e-02
cystic fibrosis 1.364 3.5e-04
group 3 medulloblastoma -1.400 1.6e-04
head and neck cancer 1.200 5.3e-03
head and neck cancer and chronic obstruc... 1.200 8.2e-03
interstitial cystitis 1.700 8.0e-03
intraductal papillary-mucinous adenoma (... -1.100 6.6e-03
lung carcinoma -2.300 9.8e-16
nasopharyngeal carcinoma 1.100 1.3e-02
non diabetic and post-ischemic heart fai... -1.200 3.7e-02
non-small cell lung cancer -1.280 9.7e-05
oligodendroglioma -1.200 5.2e-03
osteosarcoma -1.278 4.1e-02
psoriasis 2.500 1.0e-47
sarcoidosis 1.100 5.1e-04
tuberculosis -1.200 3.1e-03
uncontrolled asthma 1.500 2.9e-03

PDB (21)

Gene RIF (651)

AA Sequence

MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHG      1 - 70
EEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQR     71 - 140
ILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCT    141 - 210
FRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSK    211 - 280
KQSDTHLEET                                                                281 - 290
//

Text Mined References (664)

PMID Year Title