Property Summary

NCBI Gene PubMed Count 91
PubMed Score 966.12
PubTator Score 587.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
chronic lymphosyte leukemia 1.300 9.6e-10
Multiple myeloma -2.247 2.2e-04
cutaneous lupus erythematosus 3.000 2.7e-03
osteosarcoma -2.344 2.7e-05
periodontitis 1.900 2.2e-31
interstitial cystitis 3.000 2.9e-03
lung adenocarcinoma 1.200 9.7e-09
non-small cell lung carcinoma 1.100 1.3e-12
ulcerative colitis 2.100 1.6e-05
psoriasis 1.200 3.3e-21

Gene RIF (72)

PMID Text
26818544 HCV infection increased the frequency of CD4+CXCR5+ T cells and decreased the frequency of CD27+IgG+ B cells. CD4+CXCR5+ T cells activated CD27+IgG+ B cells via the secretion of IL-21.
26002513 results provide the first evidence for differential expression of CD27 among CLL prognostic groups, suggest a role for ZAP-70 dependent signaling in CD27 induction and implicate CD27 in cell-cell interactions with the lymphoid tissue microenvironment
25843314 Novel mutations in TNFRSF7/CD27 cause EBV-associated lymphoproliferative disease/hemophagocytic lymphohistiocytosis, Hodgkin lymphoma, uveitis, and recurrent infections.
25275127 HIV-1 Tat upregulates the expression of CD27 in stimulated CD8+ T lymphocytes
25006012 NFKB1, CD27, LAG3 and IKZF3 are new susceptibility genes for psoriasis.
24965774 Multiple layers of memory B cells to T cell- dependent antigens describe immunoglobulin IgM+ B cells representing a memory reservoir that can re-enter the germinal center, ensuring replenishment of class-switched memory CD27+ B cells.
24841128 HIV-1 Tat upregulates the expression of CD27 in stimulated CD8+ T lymphocytes
24286662 A lower primary CD24(hi) CD27(+) CD19(+) B cells may be an immunologic aspect of new-onset SLE that may be a useful tool to evaluate lupus activity and monitor the response to therapy.
24162774 HIV-1 Tat upregulates the expression of CD27 in stimulated CD8+ T lymphocytes
23826263 HIV-1 Tat upregulates the expression of CD27 in stimulated CD8+ T lymphocytes
23747721 The CCR7+CD45RA-CD27+CD28+ central memory subset is significantly decreased in the peripheral blood CD4+ T cells from rheumatoid arthritis patients.
23738704 CD27positive B cells from common variable immunodeficiency (CVID) patients are more sensitive than CD27negative B cells to spontaneous apoptosis and less sensitive to rescue from apoptosis; these B cells fail to differentiate to memory or plasma cells.
23677477 We identified soluble CD27 as an immune modulator associated with enhanced human T cell activation
23594958 Data indicate a unique expansion of CD27(high) plasmablasts in both the cerebrospinal fluid and periphery of transverse myelitis (TM). patients
23576505 These results highlight the importance of the CD27-CD70 costimulation pathway for the development of CMV-specific T cell immunity during acute and persistent infection.
23456842 CD27 and CD28 costimulatory receptors play central roles in differentiation and activation of gamma-delta T Lymphocytes. (Review)
23263849 The expression of CD27 together with CD44 showed a relationship with several established risk factors as well as response to therapy, indicating the biological significance of these molecules in acute lymphoblastic leukemia
23002119 IgM(+)IgD(+)CD27(+) but not switched B cells were strongly reduced in MYD88-, IRAK-4-, and TIRAP-deficient patients, but not UNC-93B-deficient patients.
22801960 lack of functional CD27 predisposes towards a combined immunodeficiency associated with potentially fatal EBV-driven hemo-phagocytosis, lymphoproliferation, and lymphoma development.
22429370 Decreased CD27 on B lymphocytes in patients with primary hepatocellular carcinoma.
22399187 These results indicate that CD27 and CD70 gene polymorphisms may affect the risk of breast cancer and show that some SNPs are associated with breast cancer characteristics in a northern Chinese population.
22280534 serum sCD27 level is associated with CD27 expression on lymphoma cells, and may have a role in diffuse large B-cell lymphoma
22232214 Data show that in a mouse model of chronic myelogenous leukemia, BCR/ABL+ leukemia stem and progenitor cells express CD27, and reveal a mechanism by which adaptive immunity contributes to leukemia progression.
22197273 gene deficiency is associated with combined immunodeficiency and symptomatic EBV viremia
22087280 down-regulation of CD27 on MTB-specific CD4 T cell could be used as a biomarker of active TB, potentially preceding clinical TB disease
21607290 Data show that CD27(+)/IgD(-)/ZAP70(+) memory B cells accumulate preferentially in the joints of RA, suggesting a dynamic maturation of the B cells in this compartment.
21277898 CD27 signalling does influence T(H) cell differentiation.
21237436 CD27(+) lymphocytes represent abnormal mononuclear cell populations in atrophic oral lichen planus (OLP) lesions indicating forms of OLP might exist with different pathogenesis, despite similar histology and clinical behavior.
21182090 These data collectively establish a novel role for the CD70-CD27 axis in human gammadelta T-cell activation and hence open new perspectives for its modulation in clinical settings.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20879061 CD27 may have a role in infection in systemic lupus erythematosus
20800938 no correlation between expression on T-lymphocytes and sera levels in children with asthma
20800603 Observational study of gene-disease association. (HuGE Navigator)
20699361 In this review, CD27 and CD70 constitute a unique ligand and receptor pair which can activate innate and adaptive immunity as well as regulate immunity versus tolerance.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20393787 Compared with tuberculin-positive controls, patients with bacterial culture-positive pulmonary TB had significantly reduced CD27 expression on antigen-specific CD4 T cells
20377416 The CD27(+) B-cell population was found to highly express CXCR3 in chronic hepatitis C (CHC), thus suggesting that the CD27(+) B-cell population was recruited from peripheral blood to the inflammatory site of the liver of CHC.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20201989 the CD70-CD27 interaction may play an important role in inducing effective immune responses in dendritic cell-based
19866343 higher proportion of protein-expressing B-cells in the blood of patients with systemic lupus erythematosus
19776762 CD19(+)IgM(+)D(+)CD27(-ve) memory B cells may have a distinct lineage and function, and seem relevant to understanding origins of malignant B cells, in particular those of hairy cell leukemia cells, which display mutated V genes yet lack CD27 expression
19773279 Observational study of gene-disease association. (HuGE Navigator)
19698733 A double-negative (IgD-CD27-) B cell population is increased in the peripheral blood of elderly people.
19556308 This is the first study which (i) extensively analyzes CD70 expression on human primary DC subsets and (ii) reveals that the CD70-CD27 interaction enhances not only Th1 but also Th2 differentiation of naive CD4+ T cells.
19290077 The absolute number of B lymphocytes and the percentage of naive cells (CD23-/CD27-) decreased with age whereas there was an increase in memory cells (CD27+).
19109206 CD70/CD27 interaction provides a critical stimulus for expanding effector T cells, enhancing their cytotoxic activity and improving the antileukemic effector response.
18774388 Observational study of gene-disease association. (HuGE Navigator)
18512812 a homogeneous subset of CD27-,IgD-,CD95+ memory B cells with an activated phenotype was identified in lupus patients
18322179 Lack of CD27 expression on natural killer (NK) cells is associated with high cytolytic function and, in combination with CD56, allows a better definition of cytotoxic effector cells.
18216294 A functional role for sCD27 in WM(Waldenstrom macroglobulinemia) pathogenesis, along with its utility as a surrogate marker of disease and a target in the treatment of WM.
18005092 Expression defines phenotypic stages in B cell precursor development.
17942751 marginal zone-like IgM(+)CD27(+) B cells are clonally expanded in certain subjects with mixed cryoglobulinemia (MC) offers insight into mechanisms of HCV-associated MC and B-cell malignancy
17785788 Failure to increase surface expression of costimulatory molecules CD27 and CD28 following stimulation may contribute to naive T cell impairment in HIV infection.
17548342 CD27-CD70 interactions may promote Th1 cell formation by permitting naive T cells to respond to differentiation signals and by promoting survival of activated effector T cells.
17475894 In systemic lupus erythematosus, an increased frequency of CD27-negative memory cells is significantly associated with higher disease activity index and disease-specific autoantibodies.
16951333 The memory B cell reservoir extends beyond the CD27+ compartment because B cells expressing surface IgG, but not CD27, have been found in human blood and provide further insights into B cell disorders of unknown etiology.
16802356 In systemic lupus erythematosus (SLE) patients, significant increases of CCR7-, CD27- and CCR7-, CD27+ and a reduction of CCR7+, CD27+ CD4 memory T cells were found.
16751420 Interaction of CD70 with CD27 plays a direct role in T cell activation mediated by IL-2.
16272303 functional and lineage relationships of three distinct memory CD4 subpopulations distinguished by their expression of the cysteine chemokine receptor CCR7 and the TNFR family member CD27
15685542 In primary biliary cirrhosis CpG led to a markedly high frequency of intracellular IgM-positive B cells, associated with high levels of synthesized IgM and identified to be a function of CD27(+) memory B cells.
15356138 Signals through CD70 in B lymphocytes of CD70 transgenic mice result in enhanced cell cycle entry while preventing differentiation into IgG-secreting plasma cells.
15301860 Observational study of genotype prevalence. (HuGE Navigator)
15230280 Systemic lupus erythematosus flares may relate to the retention of CD27+ memory B cells. (review)
12743427 In indolent lymphomas, sCD27 proved to be a powerful marker to predict progression-free survival (p = 0.008).
12685844 CD148 and CD27 are expressed in a wide range of B cell non-Hodgkin's lymphomas and do not serve to distinguish between neoplastic cells of naive and memory B cell derivation
12464570 CD27(-) effector CD8(+) T cells might be required for adequate control of chronic viral infection and prevention of disease development.
12324477 CD27 and CD40 co-stimulatory signals regulated the p53-amplified apoptotic pathway in B cells through the inhibition of p53-independent apoptotic pathway primarily induced by BCR ligation
12197885 IL-10 enhances B-cell IgE synthesis by promoting differentiation into plasma cells, a process that is inhibited by CD27/CD70 interaction
12009595 intragraft gene expression is a risk factor for acute cardiac allograft rejection
11976819 Increased levels of soluble CD27 in the cerebrospinal fluid are not diagnostic for leptomeningeal involvement by lymphoid malignancies.The positive predictive value of sCD27 determination for LI was only 54%, but the negative predictive value was 92%.
11801693 Functionally differentiated Vgamma9delta2+ T cells lack CD27 expression and are found in reduced numbers in immunocompromised hosts (such as healthy newborns and HIV-infected adults) and during active pulmonary tuberculosis.
9263011 HIV-1 Tat upregulates the expression of CD27 in stimulated CD8+ T lymphocytes

AA Sequence

MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVS      1 - 70
FSPDHHTRPHCESCRHCNSGLLVRNCTITANAECACRNGWQCRDKECTECDPLPNPSLTARSSQALSPHP     71 - 140
QPTHLPYVSEMLEARTAGHMQTLADFRQLPARTLSTHWPPQRSLCSSDFIRILVIFSGMFLVFTLAGALF    141 - 210
LHQRRKYRSNKGESPVEPAEPCHYSCPREEEGSTIPIQEDYRKPEPACSP                        211 - 260
//

Text Mined References (93)

PMID Year Title
26818544 2016 CD4+CXCR5+ T cells activate CD27+IgG+ B cells via IL-21 in patients with hepatitis C virus infection.
26002513 2015 Differential expression and function of CD27 in chronic lymphocytic leukemia cells expressing ZAP-70.
25843314 2015 Novel mutations in TNFRSF7/CD27: Clinical, immunologic, and genetic characterization of human CD27 deficiency.
25006012 2014 Sequencing-based approach identified three new susceptibility loci for psoriasis.
24965774 2014 The majority of human memory B cells recognizing RhD and tetanus resides in IgM+ B cells.
24286662 2013 Peripheral CD24hi CD27+ CD19+ B cells subset as a potential biomarker in naïve systemic lupus erythematosus.
23747721 2013 CD45RA-Foxp3(high) activated/effector regulatory T cells in the CCR7 + CD45RA-CD27 + CD28+central memory subset are decreased in peripheral blood from patients with rheumatoid arthritis.
23738704 2013 CD27+ B cells from a subgroup of common variable immunodeficiency patients are less sensitive to apoptosis rescue regardless of interleukin-21 signalling.
23677477 2013 Soluble CD27-pool in humans may contribute to T cell activation and tumor immunity.
23594958 Expansion of CD27high plasmablasts in transverse myelitis patients that utilize VH4 and JH6 genes and undergo extensive somatic hypermutation.
23576505 2013 CD27-CD70 costimulation controls T cell immunity during acute and persistent cytomegalovirus infection.
23456842 2013 Differentiation and activation of ?? T Lymphocytes: Focus on CD27 and CD28 costimulatory receptors.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23263849 2013 CD44 and CD27 expression pattern in B cell precursor acute lymphoblastic leukemia and its clinical significance.
23002119 2012 IgM+IgD+CD27+ B cells are markedly reduced in IRAK-4-, MyD88-, and TIRAP- but not UNC-93B-deficient patients.
22801960 2013 Combined immunodeficiency with life-threatening EBV-associated lymphoproliferative disorder in patients lacking functional CD27.
22429370 2012 Decreased CD27 on B lymphocytes in patients with primary hepatocellular carcinoma.
22399187 2012 Association of CD27 and CD70 gene polymorphisms with risk of sporadic breast cancer in Chinese women in Heilongjiang Province.
22280534 2012 Serum soluble CD27 level is associated with outcome in patients with diffuse large B-cell lymphoma treated with rituximab, cyclophosphamide, doxorubicin, vincristine and prednisolone.
22232214 2012 CD27 signaling on chronic myelogenous leukemia stem cells activates Wnt target genes and promotes disease progression.
22197273 2012 CD27 deficiency is associated with combined immunodeficiency and persistent symptomatic EBV viremia.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
22087280 2011 Monitoring CD27 expression to evaluate Mycobacterium tuberculosis activity in HIV-1 infected individuals in vivo.
21607290 B-cell subsets in the joint compartments of seropositive and seronegative rheumatoid arthritis (RA) and No-RA arthritides express memory markers and ZAP70 and characterize the aggregate pattern irrespectively of the autoantibody status.
21277898 2011 Function of CD27 in helper T cell differentiation.
21237436 2011 CD27 and CD38 lymphocytes are detected in oral lichen planus lesions.
21182090 2011 CD70-CD27 interactions provide survival and proliferative signals that regulate T cell receptor-driven activation of human ?? peripheral blood lymphocytes.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20879061 2010 Significantly higher percentage of circulating CD27(high) plasma cells in systemic lupus erythematosus patients with infection than with disease flare-up.
20800938 CD27 expression on lymphocyte and sCD27 levels in children with asthma.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20699361 2011 Role of CD27/CD70 pathway of activation in immunity and tolerance.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20393787 2010 Reduced CD27 expression on antigen-specific CD4+ T cells correlates with persistent active tuberculosis.
20377416 2010 Possible recruitment of peripheral blood CXCR3+ CD27+ CD19+ B cells to the liver of chronic hepatitis C patients.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20201989 2010 Optimal stimulation for CD70 induction on human monocyte-derived dendritic cells and the importance of CD70 in naive CD4(+) T-cell differentiation.
19866343 CD40-activated B cells from patients with systemic lupus erythematosus can be modulated by therapeutic immunoglobulins in vitro.
19776762 2009 Defining origins of malignant B cells: a new circulating normal human IgM(+)D(+) B-cell subset lacking CD27 expression and displaying somatically mutated IGHV genes as a relevant memory population.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19698733 2009 A double-negative (IgD-CD27-) B cell population is increased in the peripheral blood of elderly people.
19556308 2009 The CD70-CD27 interaction during the stimulation with dendritic cells promotes naive CD4(+) T cells to develop into T cells producing a broad array of immunostimulatory cytokines in humans.
19290077 2009 Expression of CD27 and CD23 on peripheral blood B lymphocytes in humans of different ages.
19109206 2009 The CD70/CD27 pathway is critical for stimulation of an effective cytotoxic T cell response against B cell precursor acute lymphoblastic leukemia.
18774388 2008 Genetic variation in immune signaling genes differentially expressed in asthmatic lung tissues.
18512812 2008 Activated memory B cell subsets correlate with disease activity in systemic lupus erythematosus: delineation by expression of CD27, IgD, and CD95.
18322179 2008 CD27 defines phenotypically and functionally different human NK cell subsets.
18216294 2008 CD27-CD70 interactions in the pathogenesis of Waldenstrom macroglobulinemia.
18005092 2008 CD44 and CD27 delineate B-precursor stages with different recombination status and with an uneven distribution in nonmalignant and malignant hematopoiesis.
17942751 2008 Clonal expansion of immunoglobulin M+CD27+ B cells in HCV-associated mixed cryoglobulinemia.
17785788 2007 Impaired induction of CD27 and CD28 predicts naive CD4 T cell proliferation defects in HIV disease.
17548342 2007 CD27-CD70 interactions sensitise naive CD4+ T cells for IL-12-induced Th1 cell development.
17475894 2007 A new population of cells lacking expression of CD27 represents a notable component of the B cell memory compartment in systemic lupus erythematosus.
16951333 2006 A new memory CD27-IgG+ B cell population in peripheral blood expressing VH genes with low frequency of somatic mutation.
16802356 2006 Abnormal differentiation of memory T cells in systemic lupus erythematosus.
16751420 2006 Modulation by IL-2 of CD70 and CD27 expression on CD8+ T cells: importance for the therapeutic effectiveness of cell transfer immunotherapy.
16683188 2006 The zinc containing pro-apoptotic protein siva interacts with the peroxisomal membrane protein pmp22.
16541075 2006 The finished DNA sequence of human chromosome 12.
16272303 2005 Stepwise differentiation of CD4 memory T cells defined by expression of CCR7 and CD27.
15723067 2005 Immune activation modulates hematopoiesis through interactions between CD27 and CD70.
15685542 2005 Bacterial CpG induces hyper-IgM production in CD27(+) memory B cells in primary biliary cirrhosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356138 2004 Signaling through CD70 regulates B cell activation and IgG production.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15301860 2004 Identification of single nucleotide polymorphisms in the tumor necrosis factor (TNF) and TNF receptor superfamily in the Korean population.
15230280 2004 Correlation of circulating CD27high plasma cells and disease activity in systemic lupus erythematosus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14556986 2003 CD27 synergizes with CD40 to induce IgM, IgG, and IgA antibody responses of peripheral blood B cells in the presence of IL-2 and IL-10.
12743427 Serum soluble CD27, but not thymidine kinase, is an independent prognostic factor for outcome in indolent non-Hodgkin's lymphoma.
12685844 2002 CD148 and CD27 are expressed in B cell lymphomas derived from both memory and naïve B cells.
12624711 2003 High levels of serum soluble CD27 correlated with renal dysfunction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464570 2002 Failing immune control as a result of impaired CD8+ T-cell maturation: CD27 might provide a clue.
12324477 2002 CD27 and CD40 inhibit p53-independent mitochondrial pathways in apoptosis of B cells induced by B cell receptor ligation.
12197885 2002 IL-10 enhances B-cell IgE synthesis by promoting differentiation into plasma cells, a process that is inhibited by CD27/CD70 interaction.
12009595 2002 CD27 but not CD70 and 4-1BB intragraft gene expression is a risk factor for acute cardiac allograft rejection in humans.
11062504 2000 CD27 is required for generation and long-term maintenance of T cell immunity.
10809378 2000 Memory B cells and CD27.
9862673 1998 CD27/CD70 interaction augments IgE secretion by promoting the differentiation of memory B cells into plasma cells.
9794406 1998 NF-kappaB activation in CD27 signaling: involvement of TNF receptor-associated factors in its signaling and identification of functional region of CD27.
9767422 1998 Synergistic augmentative effect of interleukin-10 and CD27/CD70 interactions on B-cell immunoglobulin synthesis.
9692890 1998 The TNF receptor family member CD27 signals to Jun N-terminal kinase via Traf-2.
9582383 1998 CD27, a member of the tumor necrosis factor receptor superfamily, activates NF-kappaB and stress-activated protein kinase/c-Jun N-terminal kinase via TRAF2, TRAF5, and NF-kappaB-inducing kinase.
9177220 1997 CD27, a member of the tumor necrosis factor receptor family, induces apoptosis and binds to Siva, a proapoptotic protein.
8580829 1995 CD27-CD70 interaction: unravelling its implication in normal and neoplastic B-cell growth.
8530100 1995 Isolation and regional assignment of human chromosome 12p cDNAs.
8186199 1994 CD70 represents the human ligand for CD27.
8120384 1994 The cloning of CD70 and its identification as the ligand for CD27.
7479974 1995 CD27-CD70 interactions regulate B-cell activation by T cells.
2837508 1988 S152 (CD27). A modulating disulfide-linked T cell activation antigen.
2442250 1987 Tissue distribution and biochemical and functional properties of Tp55 (CD27), a novel T cell differentiation antigen.
1655907 1991 The T cell activation antigen CD27 is a member of the nerve growth factor/tumor necrosis factor receptor gene family.
1334106 1992 Genomic organization and chromosomal localization of the human CD27 gene.