Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1142.73
PubTator Score 309.26

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
26336878 TEM1 expression in cancer-associated fibroblasts is correlated with a poor prognosis in patients with gastric cancer
26327620 MORAb-004 reduced CD248 on pericytes, impaired tumor microvasculature maturation and ultimately suppressed tumor development.
25680861 The authors show that endosialin, a C-type lectin, expressed in the liver exclusively by HSC and portal fibroblasts, is upregulated in liver fibrosis in mouse and man.
24716914 The genes CD248, Ephb1 and P2RY2 were detected as the top overexpressed in GC biopsies.
22824847 new monoclonal antibodies described in this paper are domain-specific and represent important reagents for the study of functional contributions of extracellular endosialin domains
22206249 [review] CD248 is a C-type lectin-like domain-containing cell surface glycoprotein that is expressed by stromal cells of proliferating tissues during embryogenesis and postnatally in tumors and inflammatory lesions.
21537839 endosialin can be detected in advanced sarcoma
21490589 CD248 defines a subset of stromal cells, including but not limited to some myofibroblasts, linked to albuminuria and tubulointerstitial damage during tissue remodeling in CKD.
21362178 Endosialin expression may be involved in the progression of rectal cancers.
20484976 Results provide evidence for a TEM-1-dependent signal pathway that controls proliferation of pericytes.
19948061 TEM1/endosialin was induced in the vasculature of high-grade brain tumors where its expression was inversely correlated with patient age.
18813310 These findings elucidate important aspects of endosialin gene regulation
18761022 endosialin is strongly expressed by pericytes during periods of active angiogenesis during embryonic and tumor development
18723498 expression of TEM1 or endosialin (CD248) and other TEM has been discovered in a population of vascular endothelial growth factor receptor 2+/CD31+/CD45-/VE-cadherin+ EPC derived from human CD133+/CD34+ cells
18490383 identified extracellular endosialin ligands and identified Mac-2 BP/90K as a specific interaction partner
18192970 endosialin is not expressed in normal human adult brain but is strongly upregulated in the angiogenic vasculature of all high-grade glioma specimens examined
18187565 experiments unambiguously demonstrate that endosialin is expressed by tumor-associated myofibroblasts & mural cells & not by endothelial cells; results validate endosialin as marker of tumor-associated myofibroblasts & tumor vessel-associated mural cells
17986615 results pinpoint to a molecular mechanism by which expression of endosialin/TEM1 in the tumor stroma and endothelium may support tumor progression and invasion
15862292 Endosialin is a marker of stromal fibroblasts and is not selectively expressed on tumor endothelium.
15624764 Endosialin colocalized with thrombomodulin, suggesting the proteins may have complementary functions in tumor progression.

AA Sequence

MLLRLLLAWAAAGPTLGQDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRV      1 - 70
DSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEH     71 - 140
RWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGAS    141 - 210
LLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPC    211 - 280
EQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISC    281 - 350
SPAGAMGAQASQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFPEDREP    351 - 420
QIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATHPTLPSAHQPPVIPATHPALSRDHQIPVIAANYP    421 - 490
DLPSAYQPGILSVSHSAQPPAHQPPMISTKYPELFPAHQSPMFPDTRVAGTQTTTHLPGIPPNHAPLVTT    491 - 560
LGAQLPPQAPDALVLRTQATQLPIIPTAQPSLTTTSRSPVSPAHQISVPAATQPAALPTLLPSQSPTNQT    561 - 630
SPISPTHPHSKAPQIPREDGPSPKLALWLPSPAPTAAPTALGEAGLAEHSQRDDRWLLVALLVPTCVFLV    631 - 700
VLLALGIVYCTRCGPHAPNKRITDCYRWVIHAGSKSPTEPMPPRGSLTGVQTCRTSV                 701 - 757
//

Text Mined References (34)

PMID Year Title
26782745 2016 Efficient construct of a large and functional scFv yeast display library derived from the ascites B cells of ovarian cancer patients by three-fragment transformation-associated recombination.
26336878 2015 TEM1 expression in cancer-associated fibroblasts is correlated with a poor prognosis in patients with gastric cancer.
26327620 2015 Targeting endosialin/CD248 through antibody-mediated internalization results in impaired pericyte maturation and dysfunctional tumor microvasculature.
25680861 2015 Hepatic stellate cell-expressed endosialin balances fibrogenesis and hepatocyte proliferation during liver damage.
24716914 2014 Increased expression of P2RY2, CD248 and EphB1 in gastric cancers from Chilean patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22824847 2012 Novel monoclonal antibodies specific for CTLD-SSC and sialomucin domains of endosialin, a mural cell marker of tumor vasculature.
22206249 2012 CD248: reviewing its role in health and disease.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21537839 2011 Endosialin is expressed in high grade and advanced sarcomas: evidence from clinical specimens and preclinical modeling.
21490589 2011 CD248+ stromal cells are associated with progressive chronic kidney disease.
21362178 2011 Endosialin expression in relation to clinicopathological and biological variables in rectal cancers with a Swedish clinical trial of preoperative radiotherapy.
20484976 2010 Endosialin/TEM-1/CD248 regulates pericyte proliferation through PDGF receptor signaling.
19948061 2009 Characterization of TEM1/endosialin in human and murine brain tumors.
18813310 2008 Hypoxia upregulates expression of human endosialin gene via hypoxia-inducible factor 2.
18761022 2008 Endosialin/TEM 1/CD248 is a pericyte marker of embryonic and tumor neovascularization.
18723498 2008 Human endothelial precursor cells express tumor endothelial marker 1/endosialin/CD248.
18490383 2008 Tumor stroma marker endosialin (Tem1) is a binding partner of metastasis-related protein Mac-2 BP/90K.
18192970 2008 Endosialin (CD248) is a marker of tumor-associated pericytes in high-grade glioma.
18187565 2008 Endosialin (Tem1) is a marker of tumor-associated myofibroblasts and tumor vessel-associated mural cells.
17986615 2007 Interaction of endosialin/TEM1 with extracellular matrix proteins mediates cell adhesion and migration.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16076089 2005 Characterization of cancer stroma markers: in silico analysis of an mRNA expression database for fibroblast activation protein and endosialin.
15862292 2005 Endosialin (TEM1, CD248) is a marker of stromal fibroblasts and is not selectively expressed on tumour endothelium.
15624764 2004 Human endosialin (tumor endothelial marker 1) is abundantly expressed in highly malignant and invasive brain tumors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11489895 2001 Molecular characterization of the mouse Tem1/endosialin gene regulated by cell density in vitro and expressed in normal tissues in vivo.
11084048 2001 Molecular cloning and characterization of endosialin, a C-type lectin-like cell surface receptor of tumor endothelium.
10947988 2000 Genes expressed in human tumor endothelium.
1438285 1992 Identification of endosialin, a cell surface glycoprotein of vascular endothelial cells in human cancer.