Property Summary

NCBI Gene PubMed Count 64
PubMed Score 798.66
PubTator Score 540.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
chronic lymphosyte leukemia -1.200 4.1e-03
cutaneous lupus erythematosus 2.400 2.0e-02
psoriasis 1.100 6.1e-04
osteosarcoma -2.953 1.7e-07
group 4 medulloblastoma -1.300 4.1e-03
interstitial cystitis 1.600 1.1e-02
adult high grade glioma -1.200 9.6e-03
posterior fossa group B ependymoma -1.200 2.8e-06
primary Sjogren syndrome 1.200 2.2e-04
nasopharyngeal carcinoma -1.400 2.7e-04
Pick disease -1.500 1.6e-04
progressive supranuclear palsy -1.300 1.0e-02

 GO Function (1)

 GO Process (1)

Gene RIF (36)

PMID Text
26507663 results demonstrate that loss of high affinity CD22 ligands on GC B-cells occurs in both mice and humans through alternative mechanisms, unmasking CD22 relative to naive and memory B-cells
26379425 Anti-CD22-magnetic nanoparticles-doxorubicin inhibited the proliferation of Raji cells, significantly increased the uptake of doxorubicin, and induced apoptosis.
26017478 MicroRNA-19a and CD22 Comprise a Feedback Loop for B Cell Response in Sepsis.
25484043 These results suggest that the in vivo mechanism of non-ligand-blocking epratuzumab may, in part, involve the unmasking of CD22 to facilitate the trans-interaction of B cells with vascular endothelium.
25182044 By using integrative genomics and analysing the relationships of COPD phenotypes with SNPs and gene expression in lung tissue, we identified CST3 and CD22 as potential causal genes for airflow obstruction.
23184497 study detected the expression of CD22 and CD72 on B cells of myasthenia gravis, compared to multiple sclerosis patient controls and healthy controls y
23083346 In the absence of functional CD22, B cells have a "hyperactivated" phenotype, CD22 dysfunction could contribute to the pathogenesis of autoimmune diseases. (Review)
22986740 The finding that CD22 is expressed on lung cancer cells is significant in revealing a heretofore unknown mechanism of tumorigenesis and metastasis
22355053 Anti-CD22 recombinant immunotoxin moxetumomab pasudotox has activity in relapsed/refractory hairy cell leukemia.
22017452 Our study implicates the CD22DeltaE12 genetic defect in the aggressive biology of relapsed or therapy-refractory paediatric B-lineage ALL.
21961844 Results obtained through a large cohort of European caucasian patients with systemic sclerosis do not support the contribution of CD19, CD20, CD22, CD24 variants to the genetic susceptibility.
21629223 This CD22-targeted polymer carrier may be useful for siRNA delivery to lymphoma cells.
21348573 Studies showed the qualitative and quantitative expression of four target surface antigens, CD19, CD20, CD22, and CD33, for which MoAbs are currently available for clinical use, in ALL.
21178327 Taken together, these results suggest that negative regulation of TLR signaling of B cells is an intrinsic property of CD22.
21178016 The efficacy of a ligand-targeting approach to B cell-specific depletion therapy for cancer may be the ability of CD22 to recycle and accumulate ligand-decorated cargo intracellularly, as an endocytic receptor.
20841423 These striking findings implicate CD22DeltaE12 as a previously undescribed pathogenic mechanism in human B-precursor leukemia.
20726320 B cell surface receptors CD20 and CD22 are significantly affected in patients with SLE, pointing to their possible involvement in the aetiopathogenesis of the disease and in the regulatory mechanisms in response to the immune disturbance.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20172905 The B-cell receptor IgM was found to be a major in situ trans ligand of CD22.
19919568 Data show that anti-CD22 autoantibodies were positive in 80% of TSK/+ mice and in 22% of SSc patients.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19150402 SAP is inducibly expressed in the human BJAB cells, and co-localizes and interacts with CD22. SAP binding to the inhibitory immunoreceptor CD22 regulates calcium mobilization in B cells.
18174230 Observational study of gene-disease association. (HuGE Navigator)
17728258 These results indicate that the alpha2-6-sialylated 6-sulfo-LacNAc determinant serves as an endogenous ligand for human CD22 and suggest the possibility that 6-GlcNAc sulfation as well as alpha2-6-sialylation may regulate Siglec-2 functions in humans.
17585360 a decrease in CD22(+) B cells and increase in CD5(+)CD22(-) B cells play critical roles in the pathogenesis of RA mediated by the activation of B cells
17562860 The results suggest that these two siglec proteins have evolved distinct endocytic mechanisms consistent with roles in cell signaling and innate immunity.
17493148 Observational study of gene-disease association. (HuGE Navigator)
17493148 study showed that a synonymous SNP in CD22, c.2304C > A, was significantly associated with susceptibility to limited cutaneous systemic sclerosis
17055225 decreased CD22 expression may be associated with the activation of B cells in Bullous pemphigoid (BP), but not associated with BP-specific antibody production
15899772 Aberrant CD22 expression is a useful marker for detection of monoclonal B cells admixed with numerous benign polyclonal B cells
15240561 masking of the alpha2-6-linked sialic acid binding site of CD22 involves many cell surface sialoglycoproteins, without requiring specific ligand(s) and/or is mediated by secondary interactions with Sias on CD45 and sIgM
12853962 B lymphocytes exposed to supernatants from HIV-1 Nef-expressing macrophages have upregulated expression of receptors CD22, CD54, and CD58
11994426 ligand-binding of CD22 influences its intracellular signaling domain and is needed for inhibition of the B cell receptor signal
11882357 Disulfide bonds and the resulting 3D conformation of the CD22 molecules may have important roles in the difference of antigenicity of CD22 beta in B cells and basophils
11826756 The Lyn/CD22/SHP-1 pathway is important in autoimmunity. Naive and tolerant B-cells differ in their calcium signaling in response to antigenic stimulation.

AA Sequence

MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSK      1 - 70
FDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERP     71 - 140
FPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQW    141 - 210
SHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWL    211 - 280
KDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVE    281 - 350
FLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK    351 - 420
KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSW    421 - 490
CSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDS    491 - 560
ISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWF    561 - 630
DWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILI    631 - 700
LAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEM    701 - 770
NIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV    771 - 840
DYVILKH                                                                   841 - 847
//

Text Mined References (66)

PMID Year Title
26507663 2015 Unmasking of CD22 Co-receptor on Germinal Center B-cells Occurs by Alternative Mechanisms in Mouse and Man.
26379425 2015 Novel synthesizing method of pH-dependent doxorubicin-loaded anti-CD22-labelled drug delivery nanosystem.
26017478 2015 MicroRNA-19a and CD22 Comprise a Feedback Loop for B Cell Response in Sepsis.
25484043 2015 Extensive crosslinking of CD22 by epratuzumab triggers BCR signaling and caspase-dependent apoptosis in human lymphoma cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25182044 2014 Genetic regulation of gene expression in the lung identifies CST3 and CD22 as potential causal genes for airflow obstruction.
23184497 2013 Modulation of B cell regulatory molecules CD22 and CD72 in myasthenia gravis and multiple sclerosis.
23083346 2012 CD22 and autoimmune disease.
22986740 2012 CD22 antigen is broadly expressed on lung cancer cells and is a target for antibody-based therapy.
22355053 2012 Phase I trial of anti-CD22 recombinant immunotoxin moxetumomab pasudotox (CAT-8015 or HA22) in patients with hairy cell leukemia.
22017452 2012 CD22 Exon 12 deletion is a characteristic genetic defect of therapy-refractory clones in paediatric acute lymphoblastic leukaemia.
21961844 Association study of B-cell marker gene polymorphisms in European Caucasian patients with systemic sclerosis.
21629223 2011 Anti-CD22 antibody targeting of pH-responsive micelles enhances small interfering RNA delivery and gene silencing in lymphoma cells.
21348573 2011 Flow cytometric study of potential target antigens (CD19, CD20, CD22, CD33) for antibody-based immunotherapy in acute lymphoblastic leukemia: analysis of 552 cases.
21178327 2011 CD22 regulates adaptive and innate immune responses of B cells.
21178016 2011 CD22 is a recycling receptor that can shuttle cargo between the cell surface and endosomal compartments of B cells.
20841423 2010 CD22 EXON 12 deletion as a pathogenic mechanism of human B-precursor leukemia.
20726320 2009 Altered CD19/CD22 balance in Egyptian children and adolescents with systemic lupus erythematosus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20172905 2010 In situ trans ligands of CD22 identified by glycan-protein photocross-linking-enabled proteomics.
19919568 2010 Autoantibody-mediated regulation of B cell responses by functional anti-CD22 autoantibodies in patients with systemic sclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19150402 2009 SAP binds to CD22 and regulates B cell inhibitory signaling and calcium flux.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
17728258 2007 Human B-lymphocytes express alpha2-6-sialylated 6-sulfo-N-acetyllactosamine serving as a preferred ligand for CD22/Siglec-2.
17585360 2007 Expression of CD22 on peripheral B cells in patients with rheumatoid arthritis: relation to CD5-positive B cells.
17562860 2007 Distinct endocytic mechanisms of CD22 (Siglec-2) and Siglec-F reflect roles in cell signaling and innate immunity.
17493148 2007 Association of CD22 gene polymorphism with susceptibility to limited cutaneous systemic sclerosis.
17055225 2006 Decreased expression levels of CD22 and L-selectin on peripheral blood B lymphocytes from patients with bullous pemphigoid.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15899772 2005 Diagnostic usefulness of aberrant CD22 expression in differentiating neoplastic cells of B-Cell chronic lymphoproliferative disorders from admixed benign B cells in four-color multiparameter flow cytometry.
15668918 2005 SLP-76 is recruited to CD22 and dephosphorylated by SHP-1, thereby regulating B cell receptor-induced c-Jun N-terminal kinase activation.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15240561 2004 Cell surface sialic acids do not affect primary CD22 interactions with CD45 and surface IgM nor the rate of constitutive CD22 endocytosis.
15133509 2004 CD22 attenuates calcium signaling by potentiating plasma membrane calcium-ATPase activity.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12646615 2003 The B cell coreceptor CD22 associates with AP50, a clathrin-coated pit adapter protein, via tyrosine-dependent interaction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11967116 2002 Haptoglobin interacts with the human mast cell line HMC-1 and inhibits its spontaneous proliferation.
11826756 2002 Lyn/CD22/SHP-1 and their importance in autoimmunity.
11551923 2001 CD22 regulates B cell receptor-mediated signals via two domains that independently recruit Grb2 and SHP-1.
11215824 CD22.
10748054 2000 CD22 forms a quaternary complex with SHIP, Grb2, and Shc. A pathway for regulation of B lymphocyte antigen receptor-induced calcium flux.
10079291 1999 Identification of the gene variations in human CD22.
9890995 1999 Definition of the sites of interaction between the protein tyrosine phosphatase SHP-1 and CD22.
9774390 1998 Internalization of the lymphocytic surface protein CD22 is controlled by a novel membrane proximal cytoplasmic motif.
9143697 1997 CD22, a B lymphocyte-specific adhesion molecule that regulates antigen receptor signaling.
9120258 1997 Membrane IgM-induced tyrosine phosphorylation of CD19 requires a CD19 domain that mediates association with components of the B cell antigen receptor complex.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8702538 1996 A single N-linked glycosylation site is implicated in the regulation of ligand recognition by the I-type lectins CD22 and CD33.
8647200 1996 Involvement of p72syk kinase, p53/56lyn kinase and phosphatidyl inositol-3 kinase in signal transduction via the human B lymphocyte antigen CD22.
8627166 1996 CD22 associates with protein tyrosine phosphatase 1C, Syk, and phospholipase C-gamma(1) upon B cell activation.
8496602 1993 Genomic structure and chromosomal mapping of the human CD22 gene.
8475064 1993 CD22 associates with the human surface IgM-B-cell antigen receptor complex.
8463235 1993 Natural ligands of the B cell adhesion molecule CD22 beta carry N-linked oligosaccharides with alpha-2,6-linked sialic acids that are required for recognition.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7925291 1994 Sialoadhesin, a macrophage sialic acid binding receptor for haemopoietic cells with 17 immunoglobulin-like domains.
7618087 1995 A role in B cell activation for CD22 and the protein tyrosine phosphatase SHP.
7537381 1995 Regulation of CD45 engagement by the B-cell receptor CD22.
1985119 1991 cDNA cloning of the B cell membrane protein CD22: a mediator of B-B cell interactions.
1691828 1990 The B-cell antigen CD22 mediates monocyte and erythrocyte adhesion.
1401903 1992 Identification and characterization of the murine homologue of CD22, a B lymphocyte-restricted adhesion molecule.