Property Summary

NCBI Gene PubMed Count 43
PubMed Score 76.01
PubTator Score 49.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Rhinitis 1.300 4.6e-03
uncontrolled asthma 1.500 2.7e-03
medulloblastoma, large-cell 1.500 1.6e-04
adult high grade glioma 1.200 1.7e-03
mucosa-associated lymphoid tissue lympho... 1.761 2.6e-02

Gene RIF (32)

PMID Text
26690123 Inflammatory Bowel Disease patients showed a significant decrease in the percentage of plasmacytoid dendritic cells and myeloid dendritic cells expressing CD200R1 compared to that of the control group.
26538068 The authors showed that the viral orthologues e127 from rat cytomegalovirus and K14 from human herpesvirus 8 do not bind the activating CD200R-like proteins from their respective species, although they do bind the inhibitory receptors.
26123445 CD200-CD200R1 signaling may be required for human pregnancy success.
26011475 This is the first report of CD200R1 expression by human epithelial tumor cells, and specifically, early-stage human breast cancer cells. It is also the first report of CD200R1 expression by term placental villous trophoblasts.
25404054 data show that the expression of CD200R, CD95 and CD95L was influenced by cardiac surgery and imply the role of these membrane molecules in cell regulation-inhibition and apoptosis following cardiac surgery.
25261692 The proportion of CD200R1+ cells in PBMCs, peripheral CD14+ cells and CD4+ T cells was significantly lower in rheumatoid arthritis patients compared to controls.
25145957 The mechanism underlying ESA might be associated with enhanced expression of CD200 and CD200R in the trophoblast, leading to an upregulation of the immune response during the first trimester of pregnancy.
24496593 We demonstrate a significant correlation between CD200R1 positive cells and disease severity in rheumatoid arthritis (RA) patients, thus indicating the relevance of the CD200/CD200R1 signaling pathway potential involvement in the pathogenesis of RA.
24388216 [review] CD200R1 is comparable to other pathogen-targeted inhibitory receptors; its signaling pathway is utilized by a diverse number of pathogens and represents a novel targeting strategy for infectiouis diseases.
24333170 Measurement of sCD200 and/or sCD200R1 may prove a useful and rapid means of monitoring subjects at risk of bone loss.
23940819 Mesenchymal stem cells, through the expression of CD200, play a major role in the regulation of bone resorption and bone physiology and the CD200-CD200R couple could be a new target to control bone diseases.
23690219 The expression of CD200 and its receptor, CD200R, on CD83+ monocyte-derived dendritic cells (Mo-DCs), pulsed or not with autologous tumor cell lysates (aTCL) in patients who suffer from laryngeal carcinoma, were examined.
23560298 in cutaneous squamous cell carcinoma, CD200 expression on local blood vessels may promote tumor progression by suppressing CD200R myeloid cells during diapedesis
23541619 blocking CD200 on tumor cells may have opposite effects on tumor proliferation depending on the "affinity" of the macrophages to form the CD200-CD200R-complex with tumor cells.
23066977 The expression of CD200R as well as B7-H4 co-stimulatory molecules on CD14(+) cells were significantly higher in cord blood when compared with peripheral blood.
22621248 CD200 and CD200R1 expression and function are abnormal in systemic lupus erythematosus
22575528 Mesenchymal stromal cells are able to modulate the expression of both CD200 and CD200R on some T-cells.
22496920 these results indicate a role of CD200R:CD200 in T cell responses to helminths which has diagnostic and prognostic relevance as a marker of infection for chronic schistosomiasis in mouse and man.
22491458 Mechanistically, Kaposi's sarcoma-associated herpesvirus viral OX2 protein and CD200 expression on antigen presenting cells suppressed the phosphorylation of ERK1/2 mitogen-activated protein kinase in responding T cells.
22363701 The role of the CD200-CD200R axis in bone marrow-derived mesenchymal stem cell mediated immunosuppression was studied using THP-1 human macrophages.
21078907 Dok1 negatively regulates Dok2-mediated CD200R signaling through the recruitment of CrkL.
19924532 results suggest an intrinsic abnormality in the CD200-CD200R signaling in monocyte-derived macrophages during aging and, especially, in Parkinson disease
19786546 CD200R inhibits the activation of human myeloid cells through direct recruitment of Dok2 and subsequent activation of RAS p21 protein activator 1.
19151626 CD200-mediated immune suppression may occur not only via neuron-microglia interactions, but also via glia-glia interactions, especially in inflammatory conditions in which an immune-suppressive environment needs to be restored.
18164423 The CD200-CD200R pathway seems of critical relevance for macrophage-mediated damage in autoimmune inflammation of the CNS.
18040859 Review highlights the close correlation between CD200-CD200 receptor (CD200R), microglia activation, and Parkinson's disease.
17714785 In human tonsils, CD200R is differentially expressed on B cells, with high expression on memory cells and plasmablasts.
16354172 Reactions with CD200 antigen modulate immunomodulation for prevention of undesired immune responses of the skin.
16177086 Human CD200R is an important regulatory molecule of basophil activation.
15661892 CD200R represents a novel and potent inhibitory receptor that can be targeted in vivo to regulate mast cell-dependent pathologies.
15220441 Human Herpesvirus-8 K14 protein interacts with human CD200R during the lytic cycle. Despite sharing only 40% primary sequence identity, K14 and CD200 interacts with CD200R with an almost identical and low affinity (K(D) = 0.5 microM)
12960329 The CD200 receptor gene family resembles the signal regulatory proteins and killer Ig-related receptors in having receptor family members with potential activatory and inhibitory functions that may play important roles in immune regulation and balance.

AA Sequence

MLCPWRTANLGLLLILTIFLVAASSSLCMDEKQITQNYSKVLAEVNTSWPVKMATNAVLCCPPIALRNLI      1 - 70
IITWEIILRGQPSCTKAYRKETNETKETNCTDERITWVSRPDQNSDLQIRPVAITHDGYYRCIMVTPDGN     71 - 140
FHRGYHLQVLVTPEVTLFQNRNRTAVCKAVAGKPAAQISWIPEGDCATKQEYWSNGTVTVKSTCHWEVHN    141 - 210
VSTVTCHVSHLTGNKSLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTEST    211 - 280
PVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL                             281 - 325
//

Text Mined References (48)

PMID Year Title
26690123 2015 Reduced Dendritic Cells Expressing CD200R1 in Children with Inflammatory Bowel Disease: Correlation with Th17 and Regulatory T Cells.
26538068 2016 Herpesvirus orthologues of CD200 bind host CD200R but not related activating receptors.
26123445 2015 The CD200 tolerance-signaling molecule and its receptor, CD200R1, are expressed in human placental villus trophoblast and in peri-implant decidua by 5 weeks' gestation.
26011475 2015 The Receptor for the CD200 Tolerance-Signaling Molecule Associated with Successful Pregnancy is Expressed by Early-Stage Breast Cancer Cells in 80% of Patients and by Term Placental Trophoblasts.
25404054 2015 Inhibitory CD200R and proapoptotic CD95/CD95L molecules on innate immunity cells are modulated by cardiac surgery.
25261692 2015 Aberrant CD200/CD200R1 expression and its potential role in Th17 cell differentiation, chemotaxis and osteoclastogenesis in rheumatoid arthritis.
25145957 2014 Reduced CD200 and CD200R1 expression in human chorionic villi contributes to early spontaneous abortion.
24496593 2014 Decreased CD200R expression on monocyte-derived macrophages correlates with Th17/Treg imbalance and disease activity in rheumatoid arthritis patients.
24388216 2014 The CD200-CD200R1 inhibitory signaling pathway: immune regulation and host-pathogen interactions.
24333170 2014 Elevated serum soluble CD200 and CD200R as surrogate markers of bone loss under bed rest conditions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23940819 2013 CD200R/CD200 inhibits osteoclastogenesis: new mechanism of osteoclast control by mesenchymal stem cells in human.
23690219 2013 Expression of CD200 and CD200R regulatory molecules on the CD83+ monocyte-derived dendritic cells generated from patients with laryngeal cancer.
23560298 2013 CD200 upregulation in vascular endothelium surrounding cutaneous squamous cell carcinoma.
23541619 2013 The role of CD200-CD200R in tumor immune evasion.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23066977 2013 The expressions of co-stimulatory molecules are altered on putative antigen-presenting cells in cord blood.
22621248 2012 Aberrant CD200/CD200R1 expression and function in systemic lupus erythematosus contributes to abnormal T-cell responsiveness and dendritic cell activity.
22575528 2012 Characterization and functionality of the CD200-CD200R system during mesenchymal stromal cell interactions with T-lymphocytes.
22566634 2012 The genetic architecture of economic and political preferences.
22496920 2012 Chronic infection drives expression of the inhibitory receptor CD200R, and its ligand CD200, by mouse and human CD4 T cells.
22491458 2012 Suppression of antigen-specific T cell responses by the Kaposi's sarcoma-associated herpesvirus viral OX2 protein and its cellular orthologue, CD200.
22363701 2012 CD200 positive human mesenchymal stem cells suppress TNF-alpha secretion from CD200 receptor positive macrophage-like cells.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21078907 2010 Downstream of tyrosine kinase 1 and 2 play opposing roles in CD200 receptor signaling.
19924532 2010 Altered regulation of CD200 receptor in monocyte-derived macrophages from individuals with Parkinson's disease.
19786546 2009 Essential roles for Dok2 and RasGAP in CD200 receptor-mediated regulation of human myeloid cells.
19151626 2009 Distribution of the immune inhibitory molecules CD200 and CD200R in the normal central nervous system and multiple sclerosis lesions suggests neuron-glia and glia-glia interactions.
18164423 2008 CNS inflammation and neuronal degeneration is aggravated by impaired CD200-CD200R-mediated macrophage silencing.
18040859 2007 CD200-CD200R regulation of microglia activation in the pathogenesis of Parkinson's disease.
17714785 2008 The inhibitory CD200R is differentially expressed on human and mouse T and B lymphocytes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16354172 2005 CD 200-mediated regulation of skin immunity.
16177086 2005 Down-regulation of basophil function by human CD200 and human herpesvirus-8 CD200.
15661892 2005 The CD200 receptor is a novel and potent regulator of murine and human mast cell function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15274657 2004 Structural and functional heterogeneity in the CD200R family of immunoregulatory molecules and their expression at the feto-maternal interface.
15220441 2004 Human herpesvirus 8 K14 protein mimics CD200 in down-regulating macrophage activation through CD200 receptor.
15070969 2004 Expression of human prepro-orexin and signaling characteristics of orexin receptors in the male reproductive system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12960329 2003 Characterization of the CD200 receptor family in mice and humans and their interactions with CD200.
12853143 2003 Characterization of human cd200 glycoprotein receptor gene located on chromosome 3q12-13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11133863 2001 Distribution of OX2 antigen and OX2 receptor within retina.
10981966 2000 Lymphoid/neuronal cell surface OX2 glycoprotein recognizes a novel receptor on macrophages implicated in the control of their function.