Property Summary

NCBI Gene PubMed Count 154
PubMed Score 1445.11
PubTator Score 662.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.900 4.5e-07
osteosarcoma -2.905 4.5e-05
chronic lymphosyte leukemia -1.100 6.1e-05
tuberculosis 2.300 1.9e-04
active Crohn's disease -1.380 3.8e-02
interstitial cystitis 1.900 4.4e-05
primary Sjogren syndrome 1.700 4.3e-04
nasopharyngeal carcinoma -1.200 6.4e-04

 CSPA Cell Line (1)

Protein-protein Interaction (11)

Gene RIF (139)

PMID Text
26969612 Data suggest that CD1d antigen-restricted B lymphocytes (Bc) presentation of NGcGM3 drives effective invariant natural killer T cells (iNKT) activation.
26798067 the spatiotemporal distribution of CD1d molecules on the surface of antigen-presenting cells (APCs) modulates activation of Invariant natural killer T cells.
26260288 by controlling a fundamental step in CD1d-mediated lipid antigen presentation, STAT3 signalling promotes innate immune responses driven by CD1d
26119195 both membrane-bound (V4) and soluble (V5) isoforms of CD1d were over-expressed in gastric tumor tissues, suggesting that they are involved in anti-tumor immune responses.
26116899 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
26041373 This suggests that CD1D is more polymorphic than previously assumed
25929465 our results demonstrate that both Ets1 and miR-155 can directly regulate the expression of CD1d on B-cells
25878107 Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression.
25872908 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
25827531 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
25807049 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
25649790 Using diffraction-based dotReadytrade mark immunoassays, the present study showed that staphylococcal enterotoxin B directly and specifically conjugated to CD1d.
25618030 CD1d acts as a cell surface receptor that recognizes and binds oxysterols and initializes a pathway connecting oxysterol binding to PPARgamma activation
25477528 CD1d expression in renal cell carcinoma correlated with aggressive disease and poorer clinical outcomes.
25452463 These findings highlight how components from alphabeta and gammadeltaTCR gene loci can recombine to confer antigenic specificity.
25390653 simplexide, apart from activating iNKT cells, induces the production of cytokines and chemokines from human monocytes by direct interaction with CD1d
25381357 Expression of CD1d on B cells is suggestive of the ability of these cells to present antigens to, and form cognate interactions with, invariant natural killer T-Cells. (Review)
25275127 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
25115738 High CD1d expression is associated with medulloblastomas.
24556395 [review] Humans express both Group 1 (CD1a, CD1b and CD1c) and Group 2 (CD1d) CD1 molecules with nonredundant functions in response to the presentation of endogenous lipids.
24513807 CXCL16, iNKT cell-associated cell marker Valpha24, and CD1d were significantly upregulated in esophageal biopsies from EoE patients and correlated with the expression of inflammatory mediators associated with allergy.
24418751 Relationship between high CD1d expression and shorter time to treatment and overall survival in chronic lymphocytic leukemia. CD1d expression in individual patients significantly changed over time.
24307737 these results provide new insight into the control of CD1d gene expression, and they have implications for the evolution of CD1d and type I NKT cells.
24213674 results showed the interaction between endoplasmic reticulum (ER)- lumenal domain of HCMV US2 and alpha3 domain of hCD1d was observed within ER; these results show the function of HCMV US2 in immune evasive mechanisms against anti-viral immunity of invariant NKT cells
24104458 We suggest that unique set of interactions between CEACAM5, CD1d, and CD8 render CD1d more class I-like molecule, facilitating antigen presentation and activation of CD8(+)-suppressor regulatory T cells.
24076636 The gamma-delta TCR docked orthogonally, over the A' pocket of CD1d, in which the Vdelta1-chain, and the germ line-encoded CDR1d loop, dominated interactions with CD1d.
24009709 MHC class I physically associates with CD1d and regulates its functional expression on the cell surface.
23808994 CD1d was found selectively expressed on the surface of hepatocytes in chronic hepatitis C, but not those subjects with history of alcohol usage or resolved chronic hepatitis C.
23710894 our findings strongly suggest that T322 and S323 form a dual residue motif that can regulate the functional expression of CD1d during a viral infection.
23677998 for isoforms CD1b through CD1e, our simulations show the near-complete collapse of the hydrophobic cavities in the absence of the antigen. This event results from the spontaneous closure of the binding domain entrance, flanked by two alpha-helices.
23668820 Data indictate variable expression of CD1d on chronic lymphocytic leukemia (CLL)lymphocytes and an association between high expression of CD1d with shorter time to treatment and overall survival of patients.
23468111 Type II NKT cells are absolutely dependent on CD1d expression in the thymus for their selection. CD1d trafficks between the cell surface & endosomes. It plays a role in presentating lipid antigens & mycobacterial antigens. Review.
23372165 A novel, autoreactive, CD1d-restricted, GPI-specific T-cell population, enriched in an invariant TCRalpha chain, is expanded in paroxysmal noctural hemoglobinuria and may be responsible for bone marrow failure.
23347583 Downregulation of both CD1c and CD1d expression through a Vpu-dependent and Nef-independent mechanism, and the concomitant HIV-1-induced production of host cholesterol decreased the extent of CD1c and CD1d modulation.
23347583 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
23308067 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
23280365 CD1d protein structure determines species-selective antigenicity of isoglobotrihexosylceramide (iGb3) to invariant NKT cells.
23265858 Total CD1d levels are upregulated in pollen lipid-treated dendritic cells, which are then able to activate invariant natural killer (NK)T cells through a CD1d-dependent pathway.
23171451 Antigen presentation of keratinocyte to invariant killer cells show that these cells do not activate the cytotoxicity effector genes in resting iNKT-cells, but had the capacity to serve as targets for activated iNKT-cells dependent on CD1d expression.
23109910 crystallographic and biophysical analyses of alpha-galactosylceramide (alpha-GalCer) recognition by a human CD1d-restricted TCR
23049754 A correlation between CD1d expression (a negative prognostic marker) and the soluble CTLA-4 in B-ALL patients was observed.
22995911 Human and mouse type I natural killer T cell antigen receptors exhibit different fine specificities for CD1d-antigen complex
22888216 Data suggest that when CD1c is up-regulated, ILT4 is recruited to CD1c, thus reducing the inhibitory effect of immunoglobulin-like transcript 4 (ILT4) on CD1d recognition.
22829134 Recombinant Vdelta1 TCRs from different individuals were shown to bind recombinant CD1d-sulfatide complexes in a sulfatide-specific manner.
22419072 The binding of Sp1 to CD1d promoter and histone H3 acetylation on Sp1 sites were increased by histone deacetylase inhibitors.
22407918 Enhancing immunostimulatory function of human embryonic stem cell-derived dendritic cells by CD1d overexpression.
22406267 Defective B cell-mediated stimulation of iNKT cells in SLE patients was associated with altered CD1d recycling.
22395072 These findings provide insight into how lysophospholipids are presented by human CD1d molecules and how this complex is recognized by some, but not all, human Invariant Natural Killer T cells.
22103833 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
21987790 phenyl glycolipids showed greater binding avidity and stability for iNKT T-cell receptor when complexed with CD1d
21980475 CD1d appears to modulate some metabolic functions through an iNKT-independent mechanism
21956730 The serine-containing variant showed the strongest CD1d binding, offering an explanation for its predominance in vivo.
21925141 these results suggest that antigen presentation by CD1d is largely unaffected by the multiple immune-modulating functions of human cytomegalovirus.
21922073 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
21900247 Identification of self-lipids presented by CD1c and CD1d proteins.
21853044 These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity.
21846915 CD1d can differentiate chronic lymphocytic leukemia from other B-cell chronic lymphoproliferative disorders with high accuracy.
21695190 Breast cancer cells, through downregulation of CD1d and subsequent evasion of natural killer T-mediated antitumor immunity, gain increased potential for metastatic tumor progression.
21653669 identified gB and US3 as two viral factors that together downregulate CD1d surface expression; results suggest that HSV-1 uses gB and US3 to rapidly inhibit NKT cell function in the initial antiviral response
21646050 Studies indicate that CD1d-restricted T-cells can rapidly produce large amounts of Th1 and/or Th2//Treg/Th17-type cytokines, thereby regulating immunity.
21632718 Although zinc finger protein PLZF is known to direct the effector program of natural killer (NK)T cells, this study shows that CD1d naive-like cells express it at a significantly lower amount than NKT cells.
21557213 Data show that CD1d knock-out mice, which are deficient in NKT cells and resistant to ConA-induced hepatitis, no longer expressed IL-33 in hepatocytes following ConA administration.
21454514 Binding strength and dynamics of invariant natural killer cell T cell receptor/CD1d-glycosphingolipid interaction on living cells by single molecule force spectroscopy.
21451111 both CD1d and CD1c are upregulated by retinoic acid receptor alpha signaling in human B cells
21258883 CD1d gene polymorphisms are associated with breast, colorectal and lung cancers.
21198755 Myeloid dendritic cells did not change their numbers or CD1d-expression during treatment
21185200 Studies indicate that iNKT cells, CD1d dependent natural killer T cells are a unique population of T cells.
21095162 Studies indicate that NKTs can suppress tumor growth indirectly by targeting CD1d-positive elements of tumor-supportive stroma such as tumor-associated macrophages.
20861015 Calreticulin controls the rate of assembly of CD1d molecules in the endoplasmic reticulum.
20810727 CD1d is downregulated by the HPV16 E5 and HPV6 E5 protein.
20530791 Data show that the Vpu protein interacts with CD1d and suppresses its recycling from endosomal compartments to the cell surface by retaining CD1d in early endosomes.
20530791 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
20520738 These data indicate that bone marrow-dendritic cells express an endogenous CD1d ligand and B7-H1 to ihibit type II but not type I natural killer T cells.
20368272 A heretofore unknown tyrosine-based signal is demonstrated in the cytoplasmic tail of CD1d that may have relevance to other type I integral membrane proteins that traverse through the endocytic pathway.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20080535 show that the mouse and human CD1d present glycolipids having different fatty acids, based in part upon a difference at a single amino acid position that is involved in positioning the sugar epitope.
19830742 Studies indicate that during bacterial infections, NKT cells can be activated either indirectly by DC or directly by bacterial lipid antigens presented by CD1d.
19757161 A novel, high-level amplicon at 1q22-23.1 occurs in both hepatocellular carcinoma cell line and tissues.
19734232 Preferential stimulatory activities of two alpha-galactosylceramide C-glycoside analogues against human vs mouse invariant natural killer (NK)T cells are due to the differences between human vs mouse CD1d molecules.
19724888 The amount of sCD1d proteins in plasma was significantly decreased in rheumatoid arthritis patients compared with healthy donors. Plasma sCD1d protein levels correlated with the number of NKT cells in peripheral blood mononuclear cells.
19651460 Uncoupling between CD1d upregulation induced by retinoic acid and conduritol-B-epoxide and iNKT cell responsiveness.
19637196 Data suggest that IL-18-mediated activation and subsequent dysregulation of the CD1d-restricted iNKT-cells plays a role in the pathogenesis of AE.
19592659 C/EBP-beta binds to the CCAAT box in the CD1d promoter, required for its expression in keratinocytes
19454494 infiltrating NKT cells are mainly observed in CD1d nodules
19446558 Report ex vivo induction and expansion of natural killer T cells by CD1d1-Ig coated artificial antigen presenting cells.
19415116 CD1d molecules bind a surprising diversity of lipid structures within the secretory pathway
19124746 CD1d overlaps with Ig-like transcript 4 (ILT4) both at the cell surface and in the cytoplasm; its interaction with ILT4 provides insights into the regulation of natural killer T cell-mediated immunity.
19056691 A novel function of CD1d in the regulation of cell death with tumor survival and progression in humans.
18713998 Although the allogeneic activation of iNKT cells is invariant TCR-CD1d interaction-dependent, glycosphingolipid (GSL) profiling suggests it does not involve the recognition of disparate CD1d/GSL complexes
18684921 Protection from experimental autoimmune encephalomyelitis afforded by the enrichment of natural killer T cells is independent of extrathymic CD1d transgene expression.
18535199 a distinct population of human CD1d-restricted T cells specific for inflammation-associated lysolipids suggest a novel mechanism for inflammation mediated immune regulation in human cancer
18458073 CD1D expression and ligand induced cytokine production in mucosal epithelial cells from lower reproductive tract is tissue specific and CD1d-mediated cytokine production in penile urethral cells was abrogated by C. trachomatis infection.
18433720 Trophoblast differentiation is characterized by TGF-beta1-mediated decreases in trophoblast cell CD1d expression.
18385757 PKCzeta is an important transduction molecule downstream of TNF-alpha signaling and is associated with increased expression of CD1d that may enhance CD1d-natural killer T cell interactions in psoriasis lesions.
18378792 An alanine scanning mutagenesis approach was undertook to define the energetic basis of this interaction between the natural killer cell T cell receptors and CD1d.
18337560 monocyte-derived DCs cultured in an immunoglobulin-rich milieu expressed CD1d but not CD1a, CD1b, and CD1c, whereas DCs cultured in the presence of low levels of immunoglobulins had an opposite CD1 profile
18253929 Data indicate that viral danger signals trigger NKT cell activation by enhancing CD1d de novo synthesis through increasing the abundance of CD1D mRNA in human myeloid dendritic cells.
18068183 Used a lentiviral system to generate stable cell lines producing beta2m-CD1d single chain protein which was used to form CD1d tetramer.
17726154 These results indicate that CD4 can contribute to natural killer cell activation independently of the presence of a CD4-ligand on antigen presenting cells and suggest that it preferentially modulates cytokine and proliferative responses.
17581592 The structure provides a basis for the interaction between the highly conserved NKT TCR alpha-chain and the CD1d-antigen complex
17476670 CD1d-restricted NKT cells have roles in the intestine and in inflammatory bowel diseases [review]
17475845 Cotrafficking with major histocompatibility class II molecules and the invariant chain (Ii) selectively enhances CD1d-mediated presentation of exogenous antigens.
17372201 saposin B may facilitate lipid binding to CD1d molecules throughout the endocytic pathway
17363727 CD4 potentiates human iNKT cell activation by engaging CD1d molecules. These results indicate that the CD4 coreceptors may contribute to the fine tuning of iNKT cells reactivity.
17071611 One of the N-linked glycans (at position asparagine-42) exists mainly in a form that is sensitive to endoglycosidase H. Deletion of Asn-42 affects stability of the CD1d heavy chain beta 2-microglobulin heterodimer.
17071498 CD1d has a role in cytolysis of lymphoblastic lymphoma cells
17015708 Schwann cells activated iNKT cells in a CD1d-dependent manner in the presence of alpha-galactosylceramide
16820217 Observational study of gene-disease association. (HuGE Navigator)
16818729 This review highlights the role of the CD1d antigen processing pathway and the immunopotentiating effects of the ligands that can be presented by CD1d to natural killer (NK)T cells or other CD1d-restricted T cells during cancer and infections.
16675349 CD1d-restricted gamma delta T cells specific for phospholipids can represent a key mucosal regulatory subset for the control of early host reactivity against tree pollens.
16517731 These results highlight the variation in Ag recognition among CD1d-restricted Receptors, Antigen, T-Cell (TCRs) and suggest that TCR alpha-chain elements contribute to alpha-linked glycosphingolipid specificity [CD1d]
16456021 Time-course studies of CD1d gene expression indicated that keratinocytes slowly increased gene expression with CaCl(2)-induced terminal differentiation
16454711 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
16385629 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
16178273 CD1d has a role in intrahepatic T-cell recognition in hepatocytes
16148122 CD1d continues to play a role in late-stage NKT cell development and, in particular, during the functionally significant acquisition of NK1.1 that is indicative of NKT cell maturity
16091469 CD1d ligation alone, in the absence of iNKT, could rapidly (within 24 h) stimulate production of bioactive IL-12p70 by CD1d+ human peripheral blood monocytes as well as immature dendritic cells
16007090 analysis of the crystal structure of human CD1d in complex with synthetic alpha-galactosylceramide at a resolution of 3.0 A
15916790 ability of Nef to alter the cell surface expression of human CD1d. In cells co-expressing CD1d and Nef, a reduction in the cell surface level of CD1d was observed.
15916790 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
15790518 HIV-1 Vpr downregulates the expression of CD1D in human monocyte-derived dendritic cells
15665086 CD1d-dimer staining revealed human natural killer T cells reactivity toward Sphingomonas glycosphingolipids.
15654963 TGFbeta produced by keratinocytes contribute to selectively downregulate CD1d expression on intraepidermal-resident Langerhans cells
15345586 The ability of CD1d-unrestricted natural killer T cells to recruit innate immune system cells might play a role in cancer cell eradication and contribute to inflammatory diseases.
15265953 Hepatic inflammatory cells & biliary cells near portal tract fibrotic areas of HCV-infected donors specifically up-regulate CD1d. CD1d presentation of liver Ag may be beneficial in acute viral clearance, but in chronic infection could add to liver injury.
15243159 Data show that phosphatidylinositol mannoside represents a mycobacterial antigen recognized by T cells in the context of CD1d.
15187105 CD1d can inhibit NK cell-mediated cytolysis; the putative inhibitory receptor does not recognize CD1d molecules loaded with alpha-GalCer
15128771 Transgenic overexpression of CD1d within pancreatic islets of nonobese diabetic (NOD) mice protects them from autoimmune diabetes through activation of NKT cells and improvement of IL-4 secretion at the site of autoimmunity (i.e., peripheral lymph nodes).
15100293 Investigation of the 5' upstream region of human CD1D reveals multiple transcription initiation sites and TATA boxless dual promoters located within 700 base pairs 5' upstream of the coding region.
14716312 saposins mobilize monomeric lipids from lysosomal membranes and facilitate their association with CD1d
14551186 CD1d proteins sre strong binders of small hydrophobic probes such as 1-anilinonaphthalene-8-sulfonic acid and 4,4'-dianilino-1,1'-naphthyl-5,5'-disulfonic acid.
12952923 a novel autocrine pathway of CD1d regulation by Hsp110.
12730881 CD1d is expressed functionally on IECs with a polarity of presentation (basal > apical) predicting a role in presentation of mucosal glycolipid antigens to local CD1d-restricted T cells.
12618910 the CD1d alpha1-alpha2 domains of both rhesus monkeys and humans are highly homologous (95.6%)
12454749 B cell chronic lymphocytic leukemia cells significantly down-regulated transcripts from CD1c and CD1d genes, permitting cells to evade the immune response
12368486 CD1d ligand at the human maternal-fetal interface
12239218 Data show that CD1d associates in the ER with both calnexin and calreticulin and with the thiol oxidoreductase ERp57 in a manner dependent on glucose trimming of its N-linked glycans.
11580851 Observational study of gene-disease association. (HuGE Navigator)
9374463 CD1d presents lipid and glycolipid antigens to T cells

AA Sequence

MGCLLFLLLWALLQAWGSAEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKP      1 - 70
WSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKD     71 - 140
ILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLS    141 - 210
RGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCR    211 - 280
VKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL                   281 - 335
//

Text Mined References (156)

PMID Year Title
26969612 2016 The tumor antigen N-glycolyl-GM3 is a human CD1d ligand capable of mediating B cell and natural killer T cell interaction.
26798067 2016 The actin cytoskeleton modulates the activation of iNKT cells by segregating CD1d nanoclusters on antigen-presenting cells.
26260288 2015 STAT3 promotes CD1d-mediated lipid antigen presentation by regulating a critical gene in glycosphingolipid biosynthesis.
26119195 2015 Increased Expression of Two Alternative Spliced Variants of CD1d Molecule in Human Gastric Cancer.
26041373 2015 Increased CD1D polymorphism: identification of two novel alleles, CD1D*03 and *04, in individuals from Morocco.
25929465 2015 TLR9-induced miR-155 and Ets-1 decrease expression of CD1d on B cells in SLE.
25878107 2015 Herpes Simplex Virus 1 US3 Phosphorylates Cellular KIF3A To Downregulate CD1d Expression.
25649790 2015 Characterization of the interaction of staphylococcal enterotoxin B with CD1d expressed in human renal proximal tubule epithelial cells.
25618030 2015 CD1d serves as a surface receptor for oxidized cholesterol induction of peroxisome proliferator-activated receptor-?.
25477528 2015 CD1d expression in renal cell carcinoma is associated with higher relapse rates, poorer cancer-specific and overall survival.
25452463 2014 The molecular bases of ?/?? T cell-mediated antigen recognition.
25390653 2014 Simplexide induces CD1d-dependent cytokine and chemokine production from human monocytes.
25381357 2014 Role and regulation of CD1d in normal and pathological B cells.
25115738 2014 Therapeutic implications of CD1d expression and tumor-infiltrating macrophages in pediatric medulloblastomas.
24556395 2014 Lipid presentation by human CD1 molecules and the diverse T cell populations that respond to them.
24513807 2014 Involvement of the iNKT cell pathway is associated with early-onset eosinophilic esophagitis and response to allergen avoidance therapy.
24418751 2014 CD1d expression is higher in chronic lymphocytic leukemia patients with unfavorable prognosis.
24307737 2014 Polymorphisms in the CD1d promoter that regulate CD1d gene expression are associated with impaired NKT cell development.
24213674 2013 Human cytomegalovirus (HCMV) US2 protein interacts with human CD1d (hCD1d) and down-regulates invariant NKT (iNKT) cell activity.
24104458 2014 Characterizing CEACAM5 interaction with CD8? and CD1d in intestinal homeostasis.
24076636 2013 CD1d-lipid antigen recognition by the ?? TCR.
24009709 2013 Forming a complex with MHC class I molecules interferes with mouse CD1d functional expression.
23808994 2013 Ex vivo analysis of resident hepatic pro-inflammatory CD1d-reactive T cells and hepatocyte surface CD1d expression in hepatitis C.
23710894 2013 A Thr/Ser dual residue motif in the cytoplasmic tail of human CD1d is important for the down-regulation of antigen presentation following a herpes simplex virus 1 infection.
23677998 2013 Dynamics of the antigen-binding grooves in CD1 proteins: reversible hydrophobic collapse in the lipid-free state.
23668820 2014 CD1d expression as a prognostic marker for chronic lymphocytic leukemia.
23468111 2013 CD1d and natural killer T cells in immunity to Mycobacterium tuberculosis.
23372165 2013 Glycosylphosphatidylinositol-specific, CD1d-restricted T cells in paroxysmal nocturnal hemoglobinuria.
23347583 2013 Effects of HIV-1-induced CD1c and CD1d modulation and endogenous lipid presentation on CD1c-restricted T-cell activation.
23280365 2013 CD1d protein structure determines species-selective antigenicity of isoglobotrihexosylceramide (iGb3) to invariant NKT cells.
23265858 2013 Olea europaea pollen lipids activate invariant natural killer T cells by upregulating CD1d expression on dendritic cells.
23171451 2012 CD1d-dependent, iNKT-cell cytotoxicity against keratinocytes in allergic contact dermatitis.
23109910 2012 The molecular basis for recognition of CD1d/?-galactosylceramide by a human non-V?24 T cell receptor.
23049754 2012 A soluble form of CTLA-4 is present in paediatric patients with acute lymphoblastic leukaemia and correlates with CD1d+ expression.
22995911 2012 Human and mouse type I natural killer T cell antigen receptors exhibit different fine specificities for CD1d-antigen complex.
22888216 2012 A novel role of CD1c in regulating CD1d-mediated NKT cell recognition by competitive binding to Ig-like transcript 4.
22829134 2012 The majority of CD1d-sulfatide-specific T cells in human blood use a semiinvariant V?1 TCR.
22419072 2012 CD1d induction in solid tumor cells by histone deacetylase inhibitors through inhibition of HDAC1/2 and activation of Sp1.
22407918 2012 Enhancing immunostimulatory function of human embryonic stem cell-derived dendritic cells by CD1d overexpression.
22406267 2012 Lipid-antigen presentation by CD1d(+) B cells is essential for the maintenance of invariant natural killer T cells.
22395072 2012 Lysophospholipid presentation by CD1d and recognition by a human Natural Killer T-cell receptor.
21987790 2011 Avidity of CD1d-ligand-receptor ternary complex contributes to T-helper 1 (Th1) polarization and anticancer efficacy.
21980475 2011 Impact of CD1d deficiency on metabolism.
21956730 2012 Natural variations at position 93 of the invariant V?24-J?18 ? chain of human iNKT-cell TCRs strongly impact on CD1d binding.
21925141 2011 Human CD1d molecules are resistant to human cytomegalovirus US2- and US11-mediated degradation.
21900247 2011 Identification of self-lipids presented by CD1c and CD1d proteins.
21853044 2011 Alternative spliced CD1d transcripts in human bronchial epithelial cells.
21846915 2011 The diagnostic value of CD1d expression in a large cohort of patients with B-cell chronic lymphoproliferative disorders.
21695190 2011 CD1d-expressing breast cancer cells modulate NKT cell-mediated antitumor immunity in a murine model of breast cancer metastasis.
21653669 2011 Herpes simplex virus 1 glycoprotein B and US3 collaborate to inhibit CD1d antigen presentation and NKT cell function.
21646050 2011 Developing understanding of the roles of CD1d-restricted T cell subsets in cancer: reversing tumor-induced defects.
21632718 2011 A naive-like population of human CD1d-restricted T cells expressing intermediate levels of promyelocytic leukemia zinc finger.
21557213 2011 NKT cells are required to induce high IL-33 expression in hepatocytes during ConA-induced acute hepatitis.
21454514 2011 Binding strength and dynamics of invariant natural killer cell T cell receptor/CD1d-glycosphingolipid interaction on living cells by single molecule force spectroscopy.
21451111 2011 CD1d and CD1c expression in human B cells is regulated by activation and retinoic acid receptor signaling.
21258883 2011 CD1a and CD1d genes polymorphisms in breast, colorectal and lung cancers.
21198755 2011 NK cells and CD1d-restricted NKT cells respond in different ways with divergent kinetics to IL-2 treatment in primary HIV-1 infection.
21185200 2011 Mechanism of regulation of autoimmunity by iNKT cells.
21095162 2011 Anti-tumor potential of type-I NKT cells against CD1d-positive and CD1d-negative tumors in humans.
20861015 2010 Calreticulin controls the rate of assembly of CD1d molecules in the endoplasmic reticulum.
20810727 2010 CD1d, a sentinel molecule bridging innate and adaptive immunity, is downregulated by the human papillomavirus (HPV) E5 protein: a possible mechanism for immune evasion by HPV.
20530791 2010 Inhibition of lipid antigen presentation in dendritic cells by HIV-1 Vpu interference with CD1d recycling from endosomal compartments.
20520738 2010 B7-H1-deficiency enhances the potential of tolerogenic dendritic cells by activating CD1d-restricted type II NKT cells.
20368272 2010 A threonine-based targeting signal in the human CD1d cytoplasmic tail controls its functional expression.
20363964 2010 Human CD1D gene expression is regulated by LEF-1 through distal promoter regulatory elements.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20080535 2010 Lipid binding orientation within CD1d affects recognition of Borrelia burgorferi antigens by NKT cells.
19830742 2009 NKT cells: friend or foe during viral infections?
19757161 2010 CD1d gene is a target for a novel amplicon at 1q22-23.1 in human hepatocellular carcinoma.
19734232 2009 Invariant TCR rather than CD1d shapes the preferential activities of C-glycoside analogues against human versus murine invariant NKT cells.
19724888 2009 Low levels of soluble CD1d protein alters NKT cell function in patients with rheumatoid arthritis.
19651460 2010 Uncoupling between CD1d upregulation induced by retinoic acid and conduritol-B-epoxide and iNKT cell responsiveness.
19637196 2009 IL-18 skews the invariant NKT-cell population via autoreactive activation in atopic eczema.
19592659 2009 A central role for transcription factor C/EBP-beta in regulating CD1d gene expression in human keratinocytes.
19454494 2009 Adoptive immunotherapy mediated by ex vivo expanded natural killer T cells against CD1d-expressing lymphoid neoplasms.
19446558 2009 Ex vivo induction and expansion of natural killer T cells by CD1d1-Ig coated artificial antigen presenting cells.
19415116 2009 Determination of cellular lipids bound to human CD1d molecules.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19124746 2009 Ig-like transcript 4 inhibits lipid antigen presentation through direct CD1d interaction.
19056691 2009 Regulation of multiple myeloma survival and progression by CD1d.
18713998 2008 Human invariant NKT cells display alloreactivity instructed by invariant TCR-CD1d interaction and killer Ig receptors.
18684921 2008 Invariant NKT cells regulate experimental autoimmune encephalomyelitis and infiltrate the central nervous system in a CD1d-independent manner.
18535199 2008 Inflammation-associated lysophospholipids as ligands for CD1d-restricted T cells in human cancer.
18458073 2008 Expression of CD1d and ligand-induced cytokine production are tissue specific in mucosal epithelia of the human lower reproductive tract.
18433720 2008 Expression of surface CD1d in the extravillous trophoblast cells of early gestational placenta is downregulated in a manner dependent on trophoblast differentiation.
18385757 2008 Activation of keratinocyte protein kinase C zeta in psoriasis plaques.
18378792 2008 A minimal binding footprint on CD1d-glycolipid is a basis for selection of the unique human NKT TCR.
18337560 2008 IgG regulates the CD1 expression profile and lipid antigen-presenting function in human dendritic cells via FcgammaRIIa.
18253929 2008 Viral danger signals control CD1d de novo synthesis and NKT cell activation.
18068183 2008 Generation and characterisation of CD1d tetramer produced by a lentiviral expression system.
17726154 2007 Modulation of CD1d-restricted NKT cell responses by CD4.
17581592 2007 CD1d-lipid-antigen recognition by the semi-invariant NKT T-cell receptor.
17476670 2007 Roles of CD1d-restricted NKT cells in the intestine.
17475845 2007 Distinct endosomal trafficking requirements for presentation of autoantigens and exogenous lipids by human CD1d molecules.
17372201 2007 Saposin B is the dominant saposin that facilitates lipid binding to human CD1d molecules.
17363727 2007 CD4 engagement by CD1d potentiates activation of CD4+ invariant NKT cells.
17071611 2006 An N-linked glycan modulates the interaction between the CD1d heavy chain and beta 2-microglobulin.
17071498 2006 CD1d expression level in tumor cells is an important determinant for anti-tumor immunity by natural killer T cells.
17015708 2006 Expression of CD1d molecules by human schwann cells and potential interactions with immunoregulatory invariant NK T cells.
16820217 2006 Susceptibility to Guillain-Barré syndrome is associated to polymorphisms of CD1 genes.
16818729 2006 CD1d ligands: the good, the bad, and the ugly.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16675349 2006 Recognition of pollen-derived phosphatidyl-ethanolamine by human CD1d-restricted gamma delta T cells.
16517731 2006 Conserved and heterogeneous lipid antigen specificities of CD1d-restricted NKT cell receptors.
16456021 2006 Ceramide-dependent regulation of human epidermal keratinocyte CD1d expression during terminal differentiation.
16178273 CD1d expression by hepatocytes is a main restriction element for intrahepatic T-cell recognition.
16148122 2005 The influence of CD1d in postselection NKT cell maturation and homeostasis.
16091469 2005 CD1d ligation on human monocytes directly signals rapid NF-kappaB activation and production of bioactive IL-12.
16007090 2005 The crystal structure of human CD1d with and without alpha-galactosylceramide.
15916790 2005 Impaired cell surface expression of human CD1d by the formation of an HIV-1 Nef/CD1d complex.
15665086 2005 Bacterial glycolipids and analogs as antigens for CD1d-restricted NKT cells.
15654963 2005 TGFbeta inhibits CD1d expression on dendritic cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345586 2005 CD1d-unrestricted human NKT cells release chemokines upon Fas engagement.
15265953 2004 Hepatic CD1d expression in hepatitis C virus infection and recognition by resident proinflammatory CD1d-reactive T cells.
15243159 2004 Mycobacterial phosphatidylinositol mannoside is a natural antigen for CD1d-restricted T cells.
15187105 2004 Expression of human CD1d molecules protects target cells from NK cell-mediated cytolysis.
15128771 2004 Up-regulation of CD1d expression restores the immunoregulatory function of NKT cells and prevents autoimmune diabetes in nonobese diabetic mice.
15100293 2004 Human CD1D gene has TATA boxless dual promoters: an SP1-binding element determines the function of the proximal promoter.
15032598 2004 CD1: antigen presentation and T cell function.
14716312 2004 Saposins facilitate CD1d-restricted presentation of an exogenous lipid antigen to T cells.
14551186 2004 Direct measurement of antigen binding properties of CD1 proteins using fluorescent lipid probes.
14530337 2003 Lysosomal localization of murine CD1d mediated by AP-3 is necessary for NK T cell development.
14500461 2003 Role of CD1d-restricted NKT cells in microbial immunity.
12952923 2003 Intestinal heat shock protein 110 regulates expression of CD1d on intestinal epithelial cells.
12730881 2003 Delineation of a CD1d-restricted antigen presentation pathway associated with human and mouse intestinal epithelial cells.
12618910 2003 The CD1d natural killer T-cell antigen presentation pathway is highly conserved between humans and rhesus macaques.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454749 2002 Expression profiling of B cell chronic lymphocytic leukemia suggests deficient CD1-mediated immunity, polarized cytokine response, altered adhesion and increased intracellular protein transport and processing of leukemic cells.
12415264 2002 CD1-dependent dendritic cell instruction.
12368486 2002 CD1d and invariant NKT cells at the human maternal-fetal interface.
12239218 2002 Calnexin, calreticulin, and ERp57 cooperate in disulfide bond formation in human CD1d heavy chain.
12133957 2002 The V alpha 14 NKT cell TCR exhibits high-affinity binding to a glycolipid/CD1d complex.
11968185 2002 A thymic precursor to the NK T cell lineage.
11927549 2002 Regulation of intracellular trafficking of human CD1d by association with MHC class II molecules.
11777966 2002 Lipid protein interactions: the assembly of CD1d1 with cellular phospholipids occurs in the endoplasmic reticulum.
11754812 2001 CD1d endosomal trafficking is independently regulated by an intrinsic CD1d-encoded tyrosine motif and by the invariant chain.
11580851 2001 CD1 genotyping of patients with Mycobacterium malmoense pulmonary disease.
11315191 2001 CD1d and natural T cells: how their properties jump-start the immune system.
11257307 2000 Human CD1d associates with prolyl-4-hydroxylase during its biosynthesis.
11006091 2000 Alternative splicing forms of the human CD1D gene in mononuclear cells.
10523605 1999 Binding and antigen presentation of ceramide-containing glycolipids by soluble mouse and human CD1d molecules.
10488738 1999 Polymorphism of human CD1 genes.
10473580 1999 The nonclassical class I molecule CD1d associates with the novel CD8 ligand gp180 on intestinal epithelial cells.
10221650 1999 Immunolocalization of CD1d in human intestinal epithelial cells and identification of a beta2-microglobulin-associated form.
9973405 1999 A critical tyrosine residue in the cytoplasmic tail is important for CD1d internalization but not for its basolateral sorting in MDCK cells.
9601940 1998 Structural organization of rat CD1 typifies evolutionarily conserved CD1D class genes.
9374463 1997 CD1d-restricted and TCR-mediated activation of valpha14 NKT cells by glycosylceramides.
8729450 1996 Antigen presentation by CD1 and MHC-encoded class I-like molecules.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7517575 1994 Beta 2-microglobulin-independent MHC class Ib molecule expressed by human intestinal epithelium.
3097645 1986 Isolation of CD1 genes: a family of major histocompatibility complex-related differentiation antigens.
2583117 1989 A physical map linking the five CD1 human thymocyte differentiation antigen genes.
2467814 1989 Two classes of CD1 genes.
2463622 1989 Isolation and characterization of a cDNA and gene coding for a fourth CD1 molecule.
1717564 1991 Expression of a nonpolymorphic MHC class I-like molecule, CD1D, by human intestinal epithelial cells.