Property Summary

NCBI Gene PubMed Count 53
PubMed Score 563.36
PubTator Score 735.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
chronic lymphocytic leukemia -2.159 3.2e-07
cutaneous lupus erythematosus -2.600 2.4e-03
osteosarcoma -1.668 2.6e-04
tuberculosis and treatment for 3 months 2.300 1.1e-07
non-small cell lung cancer -1.212 4.9e-17
lung cancer -3.500 4.2e-06
nasopharyngeal carcinoma -1.300 5.5e-04
lung carcinoma -1.300 2.7e-12
acute myeloid leukemia 2.100 2.7e-02

Gene RIF (33)

PMID Text
26884207 human CD1c adopts different conformations dependent on ligand occupancy of its groove, with CE and ASG stabilizing CD1c conformations that provide a footprint for binding of CD1c self-reactive T-cell receptors
25784146 There was a significant increase of blood CD1c(+) myeloid dendritic cells in autoimmune uveitis patients. The mature phenotype and function of CD1c(+) mDC1 were regulated by TNFalpha via a p38 MAPK-dependent pathway.
24935257 mLPA-specific T cells efficiently kill CD1c(+) acute leukemia cells, poorly recognize nontransformed CD1c-expressing cells, and protect immunodeficient mice against CD1c(+) human leukemia cells.
24918929 hMPV-infected BDCA-1(+) and BDCA-3(+) mDCs induced expansion of Th17 cells, in response to RSV, BDCA-1(+) mDCs induced expansion of Th1 cells and BDCA-3(+) mDCs induced expansion of Th2 cells and Tregs
24573986 decidual CD1c(+) dendritic cells with Toxoplasma gondii infection have enhanced cytotoxicity of decidual natural killer cells
24556395 [review] Humans express both Group 1 (CD1a, CD1b and CD1c) and Group 2 (CD1d) CD1 molecules with nonredundant functions in response to the presentation of endogenous lipids.
24049150 Activated dendritic cell subsets expressing CD141/CLEA9A/CD1c, likely recruited into the tubulointerstitium, are positioned to play a role in the development of fibrosis and, thus, progression to chronic kidney disease.
23829893 RSV infection induces a distinct pattern of costimulatory molecule expression and cytokine production by BDCA-1(+) and BDCA-3(+) mDCs, and impairs their ability to stimulate T cell proliferation.
23766460 Dysregulated CD1 profile in myeloid dendritic cells in CVID is normalized by IVIg treatment.
23677998 for isoforms CD1b through CD1e, our simulations show the near-complete collapse of the hydrophobic cavities in the absence of the antigen. This event results from the spontaneous closure of the binding domain entrance, flanked by two alpha-helices.
23530121 CD1c-PM complexes stain T cell receptors (TCRs), providing direct evidence for a ternary interaction among CD1c-lipid-TCR.
23468110 Molecular mechanisms by which CD1c captures distinct classes of self- and mycobacterial antigens are reviewed. Review.
23347583 Downregulation of both CD1c and CD1d expression through a Vpu-dependent and Nef-independent mechanism, and the concomitant HIV-1-induced production of host cholesterol decreased the extent of CD1c and CD1d modulation.
23347583 HIV-1 Vpu downregulates CD1c in Jurkat cells
22888216 Data suggest that when CD1c is up-regulated, ILT4 is recruited to CD1c, thus reducing the inhibitory effect of immunoglobulin-like transcript 4 (ILT4) on CD1d recognition.
22678905 Escherichia coli-activated CD1c(+) dendritic cells suppressed T-cell proliferation in an IL-10-dependent manner
21900247 Identification of self-lipids presented by CD1c and CD1d proteins.
21451111 both CD1d and CD1c are upregulated by retinoic acid receptor alpha signaling in human B cells
21436634 Accumulation of BDCA-1 and BDCA-2 around neovessels showed that mDCs and pDCs are recruited to advanced arteriosclerotic plaques.
20888334 Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19828201 A model of CD1c with bound mannosyl-beta(1)-phosphomycoketide was constructed and analyzed through molecular dynamics simulations.
19556741 CD1c+ myeloid dendritic cells were increased in idiopathic pulmonary fibrosis patients versus controls.
19468063 Data show that CD1c represents the second member of the CD1 family to present lipopeptides.
18624350 Microsomal triglyceride transfer protein regulates endogenous and exogenous antigen presentation by group 1 CD1 molecules.
18337560 monocyte-derived DCs cultured in an immunoglobulin-rich milieu expressed CD1d but not CD1a, CD1b, and CD1c, whereas DCs cultured in the presence of low levels of immunoglobulins had an opposite CD1 profile
18287231 HCMV encodes multiple blocking strategies targeting group 1 CD1 molecules CD1a, CD1b, and CD1c
16272286 identified CD1a-, CD1b-, and CD1c-restricted T cells from normal human donors that induce cytolysis and secrete copious IFN-gamma in response to self-CD1 expressed on monocyte-derived dendritic cells
15749918 hypothesis that CD1-restricted T cells might be activated and home to target tissues involved in Hashimoto's thyroiditis and Graves' disease
15556687 CD1c expression was detected on monocytes in the majority of sickle cell anemia patients, and was highly expressed in Sbeta thalassemia patients.
14551186 CD1b and CD1c show strong binding of nitrobenzoxadiazole (NBD)-labeled dialkyl-based ligands.
12454749 B cell chronic lymphocytic leukemia cells significantly down-regulated transcripts from CD1c and CD1d genes, permitting cells to evade the immune response
11580851 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLFLQFLLLALLLPGGDNADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHN      1 - 70
WSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLD     71 - 140
LLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWL    141 - 210
SSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSC    211 - 280
RVRHSSLGGQDIILYWGHHFSMNWIALVVIVPLVILIVLVLWFKKHCSYQDIL                     281 - 333
//

Text Mined References (54)

PMID Year Title
26884207 2016 Cholesteryl esters stabilize human CD1c conformations for recognition by self-reactive T cells.
25784146 2015 Increased CD1c+ mDC1 with mature phenotype regulated by TNF?-p38 MAPK in autoimmune ocular inflammatory disease.
24935257 2014 A novel self-lipid antigen targets human T cells against CD1c(+) leukemias.
24918929 2014 Paramyxovirus infection regulates T cell responses by BDCA-1+ and BDCA-3+ myeloid dendritic cells.
24573986 2014 Toxoplasma gondii infection of decidual CD1c(+) dendritic cells enhances cytotoxicity of decidual natural killer cells.
24556395 2014 Lipid presentation by human CD1 molecules and the diverse T cell populations that respond to them.
24049150 2013 Increased tubulointerstitial recruitment of human CD141(hi) CLEC9A(+) and CD1c(+) myeloid dendritic cell subsets in renal fibrosis and chronic kidney disease.
23829893 2013 Differential response of BDCA-1+ and BDCA-3+ myeloid dendritic cells to respiratory syncytial virus infection.
23766460 2013 Dysregulated CD1 profile in myeloid dendritic cells in CVID is normalized by IVIg treatment.
23677998 2013 Dynamics of the antigen-binding grooves in CD1 proteins: reversible hydrophobic collapse in the lipid-free state.
23530121 2013 CD1c tetramers detect ex vivo T cell responses to processed phosphomycoketide antigens.
23468110 2013 CD1a, CD1b, and CD1c in immunity against mycobacteria.
23347583 2013 Effects of HIV-1-induced CD1c and CD1d modulation and endogenous lipid presentation on CD1c-restricted T-cell activation.
22888216 2012 A novel role of CD1c in regulating CD1d-mediated NKT cell recognition by competitive binding to Ig-like transcript 4.
22678905 2012 Human CD1c (BDCA-1)+ myeloid dendritic cells secrete IL-10 and display an immuno-regulatory phenotype and function in response to Escherichia coli.
21900247 2011 Identification of self-lipids presented by CD1c and CD1d proteins.
21451111 2011 CD1d and CD1c expression in human B cells is regulated by activation and retinoic acid receptor signaling.
21436634 2011 Immunohistochemical characterisation of dendritic cells in human atherosclerotic lesions: possible pitfalls.
21167756 2010 The 2.5 Å structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation.
20888334 2010 Expression of dendritic cell markers CD11c/BDCA-1 and CD123/BDCA-2 in coronary artery disease upon activation in whole blood.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19828201 2009 Predicted structural basis for CD1c presentation of mycobacterial branched polyketides and long lipopeptide antigens.
19556741 2009 Increased bronchoalveolar lavage fluid CD1c expressing dendritic cells in idiopathic pulmonary fibrosis.
19468063 2009 CD1c bypasses lysosomes to present a lipopeptide antigen with 12 amino acids.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
18624350 2008 Microsomal triglyceride transfer protein regulates endogenous and exogenous antigen presentation by group 1 CD1 molecules.
18337560 2008 IgG regulates the CD1 expression profile and lipid antigen-presenting function in human dendritic cells via FcgammaRIIa.
18287231 2008 Inhibition of CD1 antigen presentation by human cytomegalovirus.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16272286 2005 CD1a-, b-, and c-restricted TCRs recognize both self and foreign antigens.
15749918 2005 CD1a and CD1c activate intrathyroidal T cells during Graves' disease and Hashimoto's thyroiditis.
15611286 2004 Mycobacterium tuberculosis pks12 produces a novel polyketide presented by CD1c to T cells.
15556687 2004 Upregulation and atypical expression of the CD1 molecules on monocytes in sickle cell disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15032598 2004 CD1: antigen presentation and T cell function.
14551186 2004 Direct measurement of antigen binding properties of CD1 proteins using fluorescent lipid probes.
12486100 2002 CD1-mediated gamma/delta T cell maturation of dendritic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12454749 2002 Expression profiling of B cell chronic lymphocytic leukemia suggests deficient CD1-mediated immunity, polarized cytokine response, altered adhesion and increased intracellular protein transport and processing of leukemic cells.
12415264 2002 CD1-dependent dendritic cell instruction.
11580851 2001 CD1 genotyping of patients with Mycobacterium malmoense pulmonary disease.
11145857 2000 Diversification of CD1 proteins: sampling the lipid content of different cellular compartments.
10899914 2000 Human CD1b and CD1c isoforms survey different intracellular compartments for the presentation of microbial lipid antigens.
10890914 2000 CD1c molecules broadly survey the endocytic system.
10786796 2000 CD1c-mediated T-cell recognition of isoprenoid glycolipids in Mycobacterium tuberculosis infection.
10626896 1999 Separate pathways for antigen presentation by CD1 molecules.
10488738 1999 Polymorphism of human CD1 genes.
8729450 1996 Antigen presentation by CD1 and MHC-encoded class I-like molecules.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7517559 1994 Alternative splicing generates secretory isoforms of human CD1.
3097645 1986 Isolation of CD1 genes: a family of major histocompatibility complex-related differentiation antigens.
2701945 1989 Expression of cDNA clones encoding the thymocyte antigens CD1a, b, c demonstrates a hierarchy of exclusion in fibroblasts.
2583117 1989 A physical map linking the five CD1 human thymocyte differentiation antigen genes.
2447586 1987 Structure and expression of the human thymocyte antigens CD1a, CD1b, and CD1c.