Property Summary

NCBI Gene PubMed Count 28
PubMed Score 47.86
PubTator Score 29.98

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 2.300 2.0e-03
osteosarcoma -1.991 6.4e-07
interstitial cystitis 2.100 2.3e-03
lung adenocarcinoma 1.400 1.6e-08
non-small cell lung carcinoma 1.100 5.3e-13

Protein-protein Interaction (1)

Gene RIF (19)

PMID Text
26555723 By associating with PIM-1L, CD180 can thus obtain autonomous signaling capabilities, and this complex is then channeling inflammatory signals into B cell survival programs
25879560 Since MEC1 cells are derived from a CLL patient with mutated IGVH genes (M-CLL) negative correlation between CD180 and CD32 expression on cycling MEC1 cells could be limited to M-CLL.
25802446 we address of monocytes functional status through assessment of the patterns of expression of Fcgamma receptors CD64, CD32, CD16 and CD180 receptor on monocytes from CLL patients and healthy individuals using specific mAbs and flow cytometry.
23103284 Data indicate that TLR9-signaling as a crucial factor for turning retinoic acid (RA) into a strong stimulator of RP105-mediated B-cell proliferation.
22484241 IL-4 failed to up-regulate expression of RP105 at the cell surface. In conclusion, the anti-inflammatory actions of IL-4 occur independently of IL-10, RP105, and the kinase activity of RIPK2
21959264 Both mouse and human RP105/MD-1 exhibit dimerization of the 1:1 RP105/MD-1 complex, demonstrating a novel organization.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20430725 Data show that CD180, CD284 and CD14 expression is higher on normal B cells than on CD19+ B-cell chronic lymphocytic leukaemia cells.
20406964 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20233331 Lower mRNA expression of LY64 was detected in gingival tissue of chronic periodontitis patients compared to healthy controls.
20133206 RP105 cross-linkaage enhanced B-lymphocyte proliferation, TLR9 expression, and growth.
19423540 Observational study of gene-disease association. (HuGE Navigator)
17448566 Expression of RP105 and TLR4 is altered on PBC monocytes, which appear to be hypersensitive to LPS, resulting in increased secretion of pro-inflammatory cytokines.
15852007 RP105 regulated TLR4 signaling in dendritic cells
12539042 Microarray analysis indicates HIV-1 Tat downregulates the expression of many proteins, including RP105, in immature dendritic cells, an effect that likely facilitates the expansion of HIV-1 infection

AA Sequence

MAFDVSCFFWVVLFSAGCKVITSWDQMCIEKEANKTYNCENLGLSEIPDTLPNTTEFLEFSFNFLPTIHN      1 - 70
RTFSRLMNLTFLDLTRCQINWIHEDTFQSHHQLSTLVLTGNPLIFMAETSLNGPKSLKHLFLIQTGISNL     71 - 140
EFIPVHNLENLESLYLGSNHISSIKFPKDFPARNLKVLDFQNNAIHYISREDMRSLEQAINLSLNFNGNN    141 - 210
VKGIELGAFDSTIFQSLNFGGTPNLSVIFNGLQNSTTQSLWLGTFEDIDDEDISSAMLKGLCEMSVESLN    211 - 280
LQEHRFSDISSTTFQCFTQLQELDLTATHLKGLPSGMKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHL    281 - 350
YIRGNVKKLHLGVGCLEKLGNLQTLDLSHNDIEASDCCSLQLKNLSHLQTLNLSHNEPLGLQSQAFKECP    351 - 420
QLELLDLAFTRLHINAPQSPFQNLHFLQVLNLTYCFLDTSNQHLLAGLPVLRHLNLKGNHFQDGTITKTN    421 - 490
LLQTVGSLEVLILSSCGLLSIDQQAFHSLGKMSHVDLSHNSLTCDSIDSLSHLKGIYLNLAANSINIISP    491 - 560
RLLPILSQQSTINLSHNPLDCTCSNIHFLTWYKENLHKLEGSEETTCANPPSLRGVKLSDVKLSCGITAI    561 - 630
GIFFLIVFLLLLAILLFFAVKYLLRWKYQHI                                           631 - 661
//

Text Mined References (31)

PMID Year Title
26555723 2015 Human CD180 Transmits Signals via the PIM-1L Kinase.
25879560 2015 Correlation of the expression of CD32 and CD180 receptors on CLL cells and MEC1 cell line.
25802446 2015 Aberrant expression of Fc?-receptors and Toll like receptor CD180 on monocytes from patients with chronic lymphocytic leukaemia.
23103284 2012 TLR9-signaling is required for turning retinoic acid into a potent stimulator of RP105 (CD180)-mediated proliferation and IgG synthesis in human memory B cells.
22484241 2012 The anti-inflammatory actions of IL-4 in human monocytes are not mediated by IL-10, RP105 or the kinase activity of RIPK2.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
21959264 2011 Crystal structures of mouse and human RP105/MD-1 complexes reveal unique dimer organization of the toll-like receptor family.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20430725 2009 Different expression of CD180, CD284 and CD14 receptors on the CD19+ subpopulation of normal and B-CLL lymphocytes.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20233331 2010 In vivo expression of Toll-like receptor 2, Toll-like receptor 4, CSF2 and LY64 in Chinese chronic periodontitis patients.
20133206 2010 Potentiation of TLR9 responses for human naïve B-cell growth through RP105 signaling.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17448566 2007 Altered expression of TLR homolog RP105 on monocytes hypersensitive to LPS in patients with primary biliary cirrhosis.
15852007 2005 Negative regulation of Toll-like receptor 4 signaling by the Toll-like receptor homolog RP105.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10880523 2000 The toll-like receptor protein RP105 regulates lipopolysaccharide signaling in B cells.
9763566 1998 RP105 is associated with MD-1 and transmits an activation signal in human B cells.
9686597 1998 Mouse MD-1, a molecule that is physically associated with RP105 and positively regulates its expression.
8975706 1996 Molecular cloning of a human RP105 homologue and chromosomal localization of the mouse and human RP105 genes (Ly64 and LY64).