Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.36
PubTator Score 1.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
psoriasis 6685 2.6e-33


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 2.6e-33

Gene RIF (1)

22471352 Found that a common variant of FCN3/CD164L2 is associated with hypertension in Chinese population.

AA Sequence

SFIGGVVLVLSLQAVAFFVLHFLKAKDSTYQTLI                                        141 - 174

Text Mined References (7)

PMID Year Title
22471352 2012 A common genetic variant of FCN3/CD164L2 is associated with essential hypertension in a Chinese population.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.