Property Summary

NCBI Gene PubMed Count 31
PubMed Score 32.49
PubTator Score 29.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Multiple myeloma 1.572 1.1e-03
ependymoma 1.900 4.5e-02
osteosarcoma 2.564 1.2e-07
glioblastoma 2.300 4.4e-05
atypical teratoid / rhabdoid tumor 2.000 6.5e-05
medulloblastoma 1.100 8.9e-03
hereditary spastic paraplegia -1.417 1.0e-02
juvenile dermatomyositis 1.197 6.1e-11
acute quadriplegic myopathy 1.480 5.9e-04
intraductal papillary-mucinous adenoma (... 1.200 2.8e-03
intraductal papillary-mucinous carcinoma... 1.500 1.8e-03
intraductal papillary-mucinous neoplasm ... 1.800 6.6e-04
pediatric high grade glioma 1.700 8.5e-05
pilocytic astrocytoma 1.300 3.2e-03
aldosterone-producing adenoma -1.269 4.6e-02
lung adenocarcinoma 1.631 8.8e-09
progressive supranuclear palsy -1.200 2.6e-02
Breast cancer 1.200 1.3e-05
ovarian cancer 2.000 1.1e-05
Down syndrome 1.500 2.1e-04
dermatomyositis 1.500 8.2e-04

Gene RIF (14)

PMID Text
26197441 This paper identified a new Deafness, Autosomal Dominant locus located on chromosome 6q15-21 and implicated CD164 as a novel gene for hearing impairment.
25980612 Infectious wild type HIV-1 production is restricted by 293T cells over-expressing CD164
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD164
24756834 miR-219 inhibits the proliferation, migration and invasion of medulloblastoma cells by targeting CD164.
24094005 Increased expression of CD164 is involved in ovarian cancer progression via the SDF-1alpha/CXCR4 axis.
22409183 CD164 is highly expressed in the colon cancer sites, and it promotes HCT116 colon cancer cell proliferation and metastasis both in vitro and in vivo
21999799 C-jun and HIF-1alpha bound to the CD164 promoter region and activated the CD164 expression.
20872290 Conclude that assessment of allergen-induced basophil CD164 upregulation is a very useful method for in vitro determination of allergy to grass pollens.
18854154 Infectious wild type HIV-1 production is restricted by 293T cells over-expressing CD164
17077324 sialomucin endolyn (CD164), an adhesion receptor that regulates the adhesion of CD34+ cells to bone marrow stroma and the recruitment of CD34+CD38(lo/-) cells into cycle, associates with CXCR4
16924678 Results demonstrate that endolyn is an evolutionarily conserved sialomucin fundamentally involved in cell proliferation in both the human and Drosophila melanogaster.
16859559 CD164 may participate in the localization of prostate cancer cells to the marrow and is further evidence that tumor metastasis and hematopoietic stem cell trafficking may involve similar processes
15916720 Data identify CD13, CD107a, and CD164 as novel basophil-activation antigens.
11862985 Review article on structure and function of CD164.

AA Sequence

MSRLSRSLLWAATCLGVLCVLSADKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSC      1 - 70
FNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVT     71 - 140
TSGTTNNTVTPTSQPVRKSTFDAASFIGGIVLVLGVQAVIFFLYKFCKSKERNYHTL                 141 - 197
//

Text Mined References (33)

PMID Year Title
27517145 2016 CD164 promotes lung tumor-initiating cells with stem cell activity and determines tumor growth and drug resistance via Akt/mTOR signaling.
27376157 2016 MicroRNA-124 suppresses tumor cell proliferation and invasion by targeting CD164 signaling pathway in non-small cell lung cancer.
26524186 2016 Expression of CD164 on Malignant T cells in Sézary Syndrome.
26197441 2015 A Novel Locus Harbouring a Functional CD164 Nonsense Mutation Identified in a Large Danish Family with Nonsyndromic Hearing Impairment.
25416956 2014 A proteome-scale map of the human interactome network.
24756834 2014 miR-219 inhibits the proliferation, migration and invasion of medulloblastoma cells by targeting CD164.
24094005 2013 CD164 regulates the tumorigenesis of ovarian surface epithelial cells through the SDF-1?/CXCR4 axis.
23792457 2014 CD164 and FCRL3 are highly expressed on CD4+CD26- T cells in Sézary syndrome patients.
23446634 2013 Genome-wide association analysis of red blood cell traits in African Americans: the COGENT Network.
22409183 2012 Inhibiting CD164 expression in colon cancer cell line HCT116 leads to reduced cancer cell proliferation, mobility, and metastasis in vitro and in vivo.
21999799 2011 Cis-regulatory functions of overlapping HIF-1alpha/E-box/AP-1-like sequences of CD164.
20872290 2010 Validation of basophil CD164 upregulation for pollen allergy diagnosis.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17077324 2007 Endolyn (CD164) modulates the CXCL12-mediated migration of umbilical cord blood CD133+ cells.
16924678 2006 The Drosophila ortholog of the endolysosomal membrane protein, endolyn, regulates cell proliferation.
16859559 2006 The role of sialomucin CD164 (MGC-24v or endolyn) in prostate cancer metastasis.
16341674 2005 Transcriptome analysis of human gastric cancer.
15916720 2005 Identification of CD13, CD107a, and CD164 as novel basophil-activation markers and dissection of two response patterns in time kinetics of IgE-dependent upregulation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11862985 CD164.
11027692 2001 Relationship between novel isoforms, functionally important domains, and subcellular distribution of CD164/endolyn.
10878358 2000 CD164 monoclonal antibodies that block hemopoietic progenitor cell adhesion and proliferation interact with the first mucin domain of the CD164 receptor.
10491205 1999 Genomic analysis of a murine cell-surface sialomucin, MGC-24/CD164.
9763543 1998 The sialomucin CD164 (MGC-24v) is an adhesive glycoprotein expressed by human hematopoietic progenitors and bone marrow stromal cells that serves as a potent negative regulator of hematopoiesis.
9680353 1998 CD164, a novel sialomucin on CD34(+) and erythroid subsets, is located on human chromosome 6q21.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1478919 1992 A novel core protein as well as polymorphic epithelial mucin carry peanut agglutinin binding sites in human gastric carcinoma cells: sequence analysis and examination of gene expression.