Property Summary

NCBI Gene PubMed Count 107
PubMed Score 249.33
PubTator Score 204.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 1.500 4.1e-04
ependymoma 1.200 5.4e-08
diabetes mellitus -1.600 3.6e-03
pediatric high grade glioma 1.600 2.2e-05
pilocytic astrocytoma 1.100 8.3e-05
sonic hedgehog group medulloblastoma 1.100 6.3e-04
subependymal giant cell astrocytoma 1.620 5.3e-03
lung carcinoma -1.400 6.7e-25
mucosa-associated lymphoid tissue lympho... 1.184 3.2e-02
ovarian cancer -1.600 1.1e-08

 GO Function (1)

Protein-protein Interaction (8)

Gene RIF (83)

PMID Text
26707073 CD151 knockdown inhibits the expression of MMP9 through the GSK-3b/bcatenin pathway and also inhibits Osteosarcoma (OS)migration and invasion in vitro and metastasis in vivo in highly metastatic OS.
26464707 In high grade DCIS, when stratified according to the HER2 status, in the HER2-negative subgroup, CD151 assessed in combination with alpha3beta1 was significantly correlated with prognosis.
26418968 the role of the CD151-alpha3beta1 complex in carcinoma progression is context dependent, and may depend on the mode of tumor cell invasion.
26377974 Data show that CD151 protein (CD151)-alpha3beta1 integrin complexes cooperated with epidermal growth factor receptor (EGFR) to drive tumor cell motility.
26245294 selective interaction with PY12 oligomers is crucial for platelet aggregation and thrombus stabilization
26136426 Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation.
25356755 our study demonstrates that CD151-alpha3beta1 integrin complexes regulate ovarian tumor growth by repressing Slug-mediated epithelial to mesenchymal transition and Wnt signaling
25351816 Knockdown CD151 expression by targeted siRNA could inhibit the related downstream intercellular signaling pathways including FAK, PI3KAKT, MEKERK1/2MAPK as well as the expression of MMP9 and VEGF.
25275127 HIV-1 Nef downregulates the cell surface expression of CD151 (TSPAN24)
25119599 Increased expression of CD151 is associated with gastric cancer.
25033048 TM4SF5 interacted with CD151, and caused the internalization of CD63 from the cell surface.
24890568 might be a potential prognostic indicator for gallbladder carcinoma
24723389 CD9 and CD151 support integrin-mediated signaling at the immunological synapse.
24495805 Data indicate that overexpression of CD151 significantly attenuated the tumor suppressive effect of miR-22.
24306658 CD151 overexpression is associated with gastric cancer.
24247563 Review on CD151 in cancer progression and metastasis.
24201754 This is the first study of the expression and prognostic potential of the tetraspanins in oral dysplasia.
24174171 CD151 expression is associated with lymphatic vessel density in prostate cancer.
24005419 The expression rate of CD151 seemed to increase gradually according to the depth of invasion and pathologic stage in gastric ademocarcinoma.
23613949 Both CD9/CD81-silenced cells and CD151-silenced cells showed delayed alpha3beta1-dependent cell spreading on laminin-332.
23570797 High CD151 expression correlated with aggressive behavior in non-small cell lung cancer.High CD151 protein expression was an independent negative prognostic factor for overall survival in lung adenocarcinoma, but not in lung squamous cell carcinomas.
23533596 CD151 is positively associated with the invasiveness of HGC, and CD151 or the combination of CD151 and integrin alpha3 is a novel marker for predicting the prognosis of HGC patient.
23302890 These data show that complex formation of CD151 with laminin-binding integrins and integration of the complex into tetraspanin-enriched microdomains are critical for human papillomavirus type 16 endocytosis.
23007325 CD151-AAA mutant was able to promote cell proliferation, while the ability of CD151AAA to promote cell proliferation was decreased compared with the CD151 group.
22986527 Data indicate that alpha3beta1 and the tetraspanin CD151 directly associate at the front and retracting rear of polarised migrating breast carcinoma cells.
22952421 clinical data analyses revealed a strong correlation between CD151 and ErbB2 expression and metastasis-free survival of breast cancer patients
22926763 Overexpression of CD151 was observed in a significant proportion of glioblastomas. CD151 overexpression was closely associated with MGMT methylation and was a prognostic factor for predicting worse survival.
22843693 CD151 links alpha(3)beta(1)/alpha(6)beta(1) integrins to Ras, Rac1, and Cdc42 by promoting the formation of multimolecular complexes in the membrane, which leads to the up-regulation of adhesion-dependent small GTPase activation
22824799 High CD151 expression is associated with skin squamous cell carcinoma.
22684562 Taken together, it was concluded that CD151 promotes the proliferation and migration of PC3 cells through the formation of CD151-integrin complex and the activation of phosphorylated ERK.
22495828 High CD151 expression is associated with glioma.
22457534 Secreted CD151 can be a useful genetic marker for the diagnosis of metastatic prostate cancer.
22338088 CD151 importantly modulates podocyte function.
22328509 CD151 support of alpha6 random defined diffusion is specific and functionally relevant, and probably underlies diverse CD151 functions in skin, kidney and cancer cells.
22294188 CD151 overexpression in breast cancer was found to be significantly associated with larger tumour size, higher nodal stage, advanced stage, absence of oestrogen receptor and progesterone receptor and human epidermal growth factor receptor 2 overexpression
21961047 Data show that CD151 acts as an important player in the progression of HCC in an integrin beta1-dependent manner.
21832275 CD151 maintains vascular stability by promoting endothelial cell adhesions, especially cell-cell adhesion, and confining cytoskeletal tension.
21428938 mAbs targeting CD151 may be of significant interest for cancer biotherapy.
21323946 High CD151 expression is associated with advanced stage and high nuclear grade in clear cell renal cell carcinoma
21320503 High expression levels of CD151 and alpha6 promote invasiveness of HCC cells.
21237282 formation of CD151-integrin complex was likely to be a prerequisite for CD151-induced angiogenesis and signaling pathways
21193415 Tetraspanin protein CD151 interacts directly with both alpha3beta1 and alpha6beta4 integrins and with other tetraspanins, thereby promoting alpha3beta1 and alpha6beta4 association with tetraspanin-enriched microdomains on the cell surface
21042756 CD151 plays a specific role in promoting prostate cancer cell motility.
20978946 High CD151 expression is associated with tumor proliferation and invasiveness in esophageal squamous cell carcinoma.
20937830 CD151 controls Met-dependent neoplastic growth by enhancing receptor signaling through beta4 integrin-mediated pathways, independent of cell-substrate adhesion
20927591 CD151, c-Met, and integrin alpha3/alpha6 were all overexpressed in pancreatic ductal adenocarcinoma. CD151 and c-Met might be new molecular markers to predict the prognosis of pancreatic ductal adenocarcinoma patients.
20715158 the expression and role of CD151 in intrahepatic cholangiocarcinoma
20581856 CD151 overexpression promotes endothelial cell proliferation, migration and tube formation via activation of the ERK signaling pathway
20578262 Overexpression of CD151 up-regulated the expression of MMP9 through the PI3K/Akt/GSK-3beta/Snail pathway and promotes neoangiogenesis and progression of hepatocellular carcinoma.
20149781 SP1 is pivotal to CD151 transcription partly via the construction of a local open chromatin configuration across the promoter.
19740096 platelet CD151 is required for regulating thrombus formation in vivo
19531562 Investigated the contribution of CD151 in breast cancer tumorigenesis using MDA-MB-231 cells as a model system. Data suggests a new role of CD151 in tumorigenesis-as an important regulator of communication between tumor cells and endothelial cells.
19509057 Data show that loss of CD151 causes excessive RhoA activation, loss of actin organization at cell-cell junctions, increased actin stress fibers, and suggest that it is also an important regulator of the stability of tumor cell-cell interactions.
19330835 Over-expression of CD151 is associated with malignancy of gingival squamous cell carcinoma.
19159612 The regulation of CD151 expression might contribute to changes in HGF/c-Met signaling and thereby modulate the phenotypic characteristics of cancer cells.
19065669 The combination of CD151/c-Met is a novel marker in predicting the prognosis of hepatocellular carcinoma and a potential therapeutic target.
18997004 Three blood group antigens genes, namely CD55, CD151, and SLC14A1, have been subjected to balancing selection, a process, rare outside MHC genes, which maintains variability at a locus.
18852263 CD151 plays an important role in post-translation modification of alpha3beta1 integrin and strongly suggest that changes in integrin glycosylation are critical for the promigratory activity of this tetraspanin.
18663148 CD151 is a key regulator of MT1-MMP in endothelial homeostasis
18508921 DHHC2 affects palmitoylation, stability, and functions of tetraspanins CD9 and CD151
18492066 CD151 regulates integrin alpha3beta1 functions in two independent aspects: potentiation of integrin alpha3beta1-mediated cell adhesion and promotion of integrin alpha3beta1-stimulated signaling events involving tyrosine phosphorylation
18451146 CD151-alpha(6) integrin complexes play a functional role in basal-like mammary tumor progression.
18328426 Demonstrate that promoting immobility through a CD151-specific metastasis blocking mAb prevents tumor cell dissemination by inhibiting intravasation without affecting primary tumor growth, tumor cell arrest, extravasation, or growth at the secondary site.
18000614 examined whether CD63-PI4K55 and CD9-PI4K55 complexes were resident in platelet-lipid rafts, or formed distinct microdomains
17716972 CD151 promotes cell migration by regulating integrin trafficking.
17632541 results elucidated the importance of CD151 as one of the key molecules for integrin-dependent carcinoma-stroma interaction
17265493 Chondrocytes with low chondrogenic capacity expressed higher levels of IGF-1, MMP-2, aggrecanase 2, while chondrocytes with high chondrogenic capacity expressed higher levels of CD44, CD151, and CD49c.
17009258 These data demonstrate that CD151 is overexpressed in osteoarthritic cartilage and suggest that CD151 plays a role in the pericellular activation of proMMP-7, leading to cartilage destruction and/or chondrocyte cloning.
16798740 homophilic interactions of CD151 stimulate integrin-dependent signaling pathways in human melanoma cells, leading to enhanced cell motility
16571677 CD151 plays a critical role in tumor cell responses to laminin-5 and reveal promotion of integrin recycling as a novel potential mechanism.
16490193 Dissociation of the CD151-integrin complex permits remodeling of epithelial cell interactions with the extracellular matrix and cell migration.
16297202 A role of CD151 in melanocyte motility was shown.
16139245 These results suggest that CD151 forms a structural and functional complex with c-Met and integrin alpha3/alpha6, and exerts its oncogenic functions through excessive activation of the HGF/c-Met signalling pathway.
15677332 Results indicate that CD151 association modulates the ligand-binding activity of integrin alpha3beta1 through stabilizing its activated conformation not only with purified proteins but also in a physiological context.
15591117 endothelial CD151 tetraspanins relocalize to the contact site with transmigrating leukocytes and associate laterally with both intercellular adhesion molecule-1 (ICAM-1) and vascular cell adhesion molecule-1 (VCAM-1)
15265795 CD151 is essential for the proper assembly of the glomerular and tubular basement membrane in kidney, has functional significance in the skin, is probably a component of the inner ear, and could play a role in erythropoiesis
15226180 CD151 is essential for normal platelet function and that disruption of CD151 induced a moderate outside-in integrin alpha(IIb)beta(3) signaling defect
12775420 HIV-1 Nef downregulates the cell surface expression of CD151 (TSPAN24)
12579280 downregulation of CD151 antigen is associated with breast tumor progression
12456024 CD151 may be involved in the interaction of platelets with the subendothelial matrix at sites of vascular damage [review]
11907260 Data demonstrate that multiple tetraspanin (transmembrane 4 superfamily) proteins such as CD151 are palmitoylated, and that palmitoylation is not required for cd151-alpha3beta1 integrin association.
11884516 Association of CD151 with the laminin-binding integrins alpha3beta1, alpha6beta1, alpha6beta4 and alpha7beta1
11809818 CD151-alpha6beta1 integrin complex acts as a functional unit that markedly influences cellular morphogenesis, with the CD151 tail is of particular importance in determining the "outside-in" functions of alpha6beta1-integrin that follow ligand engagement

AA Sequence

MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTV      1 - 70
VMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHE     71 - 140
AVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCIT    141 - 210
KLETFIQEHLRVIGAVGIGIACVQVFGMIFTCCLYRSLKLEHY                               211 - 253
//

Text Mined References (112)

PMID Year Title
26707073 2016 CD151 knockdown inhibits osteosarcoma metastasis through the GSK-3?/?-catenin/MMP9 pathway.
26464707 2015 Expression of CD151/Tspan24 and integrin alpha 3 complex in aid of prognostication of HER2-negative high-grade ductal carcinoma in situ.
26418968 2015 CD151 promotes ?3?1 integrin-dependent organization of carcinoma cell junctions and restrains collective cell invasion.
26377974 2015 CD151-?3?1 integrin complexes are prognostic markers of glioblastoma and cooperate with EGFR to drive tumor cell motility and invasion.
26245294 2015 A complementary role for tetraspanin superfamily member CD151 and ADP purinergic P2Y12 receptor in platelets.
26136426 2015 Tetraspanin CD151 Is a Negative Regulator of Fc?RI-Mediated Mast Cell Activation.
25416956 2014 A proteome-scale map of the human interactome network.
25356755 2014 CD151-?3?1 integrin complexes suppress ovarian tumor growth by repressing slug-mediated EMT and canonical Wnt signaling.
25351816 2015 Effects of tetraspanin CD151 inhibition on A549 human lung adenocarcinoma cells.
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
25119599 2014 miR-152 suppresses gastric cancer cell proliferation and motility by targeting CD151.
25033048 2014 Correlations between transmembrane 4 L6 family member 5 (TM4SF5), CD151, and CD63 in liver fibrotic phenotypes and hepatic migration and invasive capacities.
24890568 2014 Role of CD151 expression in gallbladder carcinoma.
24723389 2014 Tetraspanins CD9 and CD151 at the immune synapse support T-cell integrin signaling.
24553111 2014 The tetraspanin CD151 in papillomavirus infection.
24495805 2014 MiR-22 suppresses the proliferation and invasion of gastric cancer cells by inhibiting CD151.
24306658 2014 CD151 overexpression is associated with poor prognosis in patients with pT3 gastric cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24247563 2014 CD151 in cancer progression and metastasis: a complex scenario.
24220332 2013 Disease-associated single amino acid mutation in the calf-1 domain of integrin ?3 leads to defects in its processing and cell surface expression.
24201754 2013 Tetraspanins CD9 and CD151, epidermal growth factor receptor and cyclooxygenase-2 expression predict malignant progression in oral epithelial dysplasia.
24174171 2014 CD151 is associated with prostate cancer cell invasion and lymphangiogenesis in vivo.
24005419 2013 Tetraspanin CD151 expression associated with prognosis for patients with advanced gastric cancer.
23613949 2013 The CD9/CD81 tetraspanin complex and tetraspanin CD151 regulate ?3?1 integrin-dependent tumor cell behaviors by overlapping but distinct mechanisms.
23570797 2013 Prognostic significance of CD151 overexpression in non-small cell lung cancer.
23533596 2013 Overexpression of CD151 predicts prognosis in patients with resected gastric cancer.
23302890 2013 Tetraspanin CD151 mediates papillomavirus type 16 endocytosis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23007325 2012 CD151 promotes cancer cell metastasis via integrins ?3?1 and ?6?1 in vitro.
22986527 2013 ?3?1 integrins regulate CD151 complex assembly and membrane dynamics in carcinoma cells within 3D environments.
22952421 2012 Integrin-associated CD151 drives ErbB2-evoked mammary tumor onset and metastasis.
22926763 2013 Prognostic significance of tetraspanin CD151 in newly diagnosed glioblastomas.
22843693 2012 Tetraspanin CD151 stimulates adhesion-dependent activation of Ras, Rac, and Cdc42 by facilitating molecular association between ?1 integrins and small GTPases.
22824799 2013 Tetraspanin CD151 plays a key role in skin squamous cell carcinoma.
22684562 2012 CD151 promotes proliferation and migration of PC3 cells via the formation of CD151-integrin ?3/?6 complex.
22495828 2013 Knockdown of cathepsin B and uPAR inhibits CD151 and ?3?1 integrin-mediated cell adhesion and invasion in glioma.
22457534 2012 Proteomic analysis of microvesicles released by the human prostate cancer cell line PC-3.
22338088 2012 Morphology and migration of podocytes are affected by CD151 levels.
22328509 2012 CD151 restricts the ?6 integrin diffusion mode.
22294188 2012 Clinical significance of CD151 overexpression in subtypes of invasive breast cancer.
21961047 2011 Profiling of the tetraspanin CD151 web and conspiracy of CD151/integrin ?1 complex in the progression of hepatocellular carcinoma.
21832275 2011 Tetraspanin CD151 maintains vascular stability by balancing the forces of cell adhesion and cytoskeletal tension.
21428938 2011 Tetraspanin CD151 as a target for antibody-based cancer immunotherapy.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21323946 2011 CD151 expression can predict cancer progression in clear cell renal cell carcinoma.
21320503 2011 CD151 amplifies signaling by integrin ?6?1 to PI3K and induces the epithelial-mesenchymal transition in HCC cells.
21269460 2011 Initial characterization of the human central proteome.
21237282 2011 Role of tetraspanin CD151-?3/?6 integrin complex: Implication in angiogenesis CD151-integrin complex in angiogenesis.
21193415 2011 Structure-function analysis of tetraspanin CD151 reveals distinct requirements for tumor cell behaviors mediated by ?3?1 versus ?6?4 integrin.
21042756 2010 The migration and invasion of human prostate cancer cell lines involves CD151 expression.
20978946 2011 Prognostic significance of CD151 expression in esophageal squamous cell carcinoma with aggressive cell proliferation and invasiveness.
20937830 2010 The tetraspanin CD151 is required for Met-dependent signaling and tumor cell growth.
20927591 2011 Expression and prognostic significance of CD151, c-Met, and integrin alpha3/alpha6 in pancreatic ductal adenocarcinoma.
20715158 2010 Overexpression of CD151 as an adverse marker for intrahepatic cholangiocarcinoma patients.
20581856 2010 Activation of the ERK signaling pathway is involved in CD151-induced angiogenic effects on the formation of CD151-integrin complexes.
20578262 2010 CD151 modulates expression of matrix metalloproteinase 9 and promotes neoangiogenesis and progression of hepatocellular carcinoma.
20149781 2010 SP1 is required for basal activation and chromatin accessibility of CD151 promoter in liver cancer cells.
19740096 2009 A platelet tetraspanin superfamily member, CD151, is required for regulation of thrombus growth and stability in vivo.
19531562 2009 CD151 regulates tumorigenesis by modulating the communication between tumor cells and endothelium.
19509057 2009 Tetraspanin CD151 regulates RhoA activation and the dynamic stability of carcinoma cell-cell contacts.
19330835 2009 Tetraspanin gene expression levels as potential biomarkers for malignancy of gingival squamous cell carcinoma.
19159612 2009 CD151 regulates HGF-stimulated morphogenesis of human breast cancer cells.
19065669 2009 Role of overexpression of CD151 and/or c-Met in predicting prognosis of hepatocellular carcinoma.
18997004 2009 Widespread balancing selection and pathogen-driven selection at blood group antigen genes.
18852263 2008 Tetraspanin CD151 regulates glycosylation of (alpha)3(beta)1 integrin.
18663148 2008 MT1-MMP collagenolytic activity is regulated through association with tetraspanin CD151 in primary endothelial cells.
18508921 2008 DHHC2 affects palmitoylation, stability, and functions of tetraspanins CD9 and CD151.
18492066 2008 The tetraspanin CD151 regulates cell morphology and intracellular signaling on laminin-511.
18451146 2008 CD151 accelerates breast cancer by regulating alpha 6 integrin function, signaling, and molecular organization.
18328426 2008 The inhibition of tumor cell intravasation and subsequent metastasis via regulation of in vivo tumor cell motility by the tetraspanin CD151.
18000614 2007 Platelet tetraspanin complexes and their association with lipid rafts.
17716972 2007 Tetraspanin CD151 promotes cell migration by regulating integrin trafficking.
17632541 2007 CD151 dynamics in carcinoma-stroma interaction: integrin expression, adhesion strength and proteolytic activity.
17265493 2007 Identification of markers to characterize and sort human articular chondrocytes with enhanced in vitro chondrogenic capacity.
17009258 2006 Tetraspanin CD151 is expressed in osteoarthritic cartilage and is involved in pericellular activation of pro-matrix metalloproteinase 7 in osteoarthritic chondrocytes.
16798740 2006 Homophilic interactions of Tetraspanin CD151 up-regulate motility and matrix metalloproteinase-9 expression of human melanoma cells through adhesion-dependent c-Jun activation signaling pathways.
16757171 2006 Current insights into the formation and breakdown of hemidesmosomes.
16571677 2006 A critical role for tetraspanin CD151 in alpha3beta1 and alpha6beta4 integrin-dependent tumor cell functions on laminin-5.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16490193 2006 Dissociation of the complex between CD151 and laminin-binding integrins permits migration of epithelial cells.
16297202 2005 Role of tetraspanins CD9 and CD151 in primary melanocyte motility.
16139245 2005 CD151 forms a functional complex with c-Met in human salivary gland cancer cells.
15677332 2005 Potentiation of the ligand-binding activity of integrin alpha3beta1 via association with tetraspanin CD151.
15591117 2005 Endothelial tetraspanin microdomains regulate leukocyte firm adhesion during extravasation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15265795 2004 CD151, the first member of the tetraspanin (TM4) superfamily detected on erythrocytes, is essential for the correct assembly of human basement membranes in kidney and skin.
15226180 2004 The tetraspanin superfamily member CD151 regulates outside-in integrin alphaIIbbeta3 signaling and platelet function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676841 2004 Tetraspanin CD81 is linked to ERK/MAPKinase signaling by Shc in liver tumor cells.
12802069 2003 Interaction of the bullous pemphigoid antigen 1 (BP230) and desmoplakin with intermediate filaments is mediated by distinct sequences within their COOH terminus.
12579280 Expression of tetraspanin adaptor proteins below defined threshold values is associated with in vitro invasiveness of mammary carcinoma cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456024 CD151.
11907260 2002 Palmitoylation of tetraspanin proteins: modulation of CD151 lateral interactions, subcellular distribution, and integrin-dependent cell morphology.
11884516 2002 Association of the tetraspanin CD151 with the laminin-binding integrins alpha3beta1, alpha6beta1, alpha6beta4 and alpha7beta1 in cells in culture and in vivo.
11809818 2002 Function of the tetraspanin CD151-alpha6beta1 integrin complex during cellular morphogenesis.
11774285 2002 CD151 enhances cell motility and metastasis of cancer cells in the presence of focal adhesion kinase.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
11337467 2001 Identification and characterization of the potential promoter regions of 1031 kinds of human genes.
11278880 2001 The major CD9 and CD81 molecular partner. Identification and characterization of the complexes.
11181065 2001 Genomic organization, amplification, fine mapping, and intragenic polymorphisms of the human hemidesmosomal tetraspanin CD151 gene.
10811835 2000 The tetraspan molecule CD151, a novel constituent of hemidesmosomes, associates with the integrin alpha6beta4 and may regulate the spatial organization of hemidesmosomes.
10447000 1999 Eukaryotic expression cloning with an antimetastatic monoclonal antibody identifies a tetraspanin (PETA-3/CD151) as an effector of human tumor cell migration and metastasis.
10229664 1999 Selective tetraspan-integrin complexes (CD81/alpha4beta1, CD151/alpha3beta1, CD151/alpha6beta1) under conditions disrupting tetraspan interactions.
10036233 1999 PETA-3/CD151, a member of the transmembrane 4 superfamily, is localised to the plasma membrane and endocytic system of endothelial cells, associates with multiple integrins and modulates cell function.
9602068 1998 Characterisation of the mouse homologue of CD151 (PETA-3/SFA-1); genomic structure, chromosomal localisation and identification of 2 novel splice forms.
9111230 1997 Localization of the transmembrane 4 superfamily (TM4SF) member PETA-3 (CD151) in normal human tissues: comparison with CD9, CD63, and alpha5beta1 integrin.
9070943 1997 Assignment of SFA-1 (PETA-3), a member of the transmembrane 4 superfamily, to human chromosome 11p15.5 by fluorescence in situ hybridization.
8627808 1996 SFA-1, a novel cellular gene induced by human T-cell leukemia virus type 1, is a member of the transmembrane 4 superfamily.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7632941 1995 Molecular cloning of cDNA encoding a novel platelet-endothelial cell tetra-span antigen, PETA-3.
1958484 1991 The murine monoclonal antibody, 14A2.H1, identifies a novel platelet surface antigen.