Property Summary

NCBI Gene PubMed Count 51
PubMed Score 72.11
PubTator Score 56.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
glioblastoma 1.900 2.0e-02
osteosarcoma 1.660 1.5e-02
posterior fossa group A ependymoma 2.800 1.1e-10
cystic fibrosis 1.376 2.5e-04
atypical teratoid / rhabdoid tumor 1.100 2.0e-02
medulloblastoma, large-cell -1.100 3.8e-03
Duchenne muscular dystrophy 1.067 2.1e-07
autosomal dominant Emery-Dreifuss muscul... 1.072 1.8e-03
primary pancreatic ductal adenocarcinoma 2.020 3.2e-04
tuberculosis -4.400 8.7e-10
non-small cell lung cancer 1.713 2.5e-11
intraductal papillary-mucinous adenoma (... -2.100 7.7e-03
pancreatic cancer 2.100 8.1e-04
interstitial cystitis 1.600 1.6e-04
pediatric high grade glioma 1.400 2.4e-02
group 4 medulloblastoma -1.700 7.7e-04
pilocytic astrocytoma 1.400 2.9e-03
lung adenocarcinoma -1.400 1.3e-04
lung carcinoma -2.800 1.3e-23
Breast cancer 1.100 4.1e-05
invasive ductal carcinoma -1.600 2.3e-02
ulcerative colitis 1.200 4.0e-03
ovarian cancer 2.600 6.2e-04

 GWAS Trait (1)

Gene RIF (38)

PMID Text
26707640 These findings indicate that CD109 is an exosomal protein and that the C-terminal region of CD109 is required for its presence in the exosome.
26621871 sCD109 can bind TGF-beta, inhibit TGF-beta binding to its receptors and decrease TGF-beta signalling and TGF-beta-induced cellular responses.
26249215 CD109 may be a potential pathology marker for gallbladder squamous cell/adenosquamous carcinomas.
26122747 In title.
26031650 CD109 overexpression was significantly associated with surgical stage, distant metastasis, and poor prognosis in myxofibrosarcoma.
25724945 Three glioblastoma cell lines, SK-MG-1, U251MG and MG178, were tested and CD109 overexpression attenuated TGF-beta1 signaling and enhanced EGF signaling in SK-MG-1, but not in U251MG or MG178.
25506915 The results suggest that circulating endothelial cells express CD109 and represent a rare population of circulating tumor endothelial cells, that play a potentially useful prognostic role in patients with glioblastoma.
25388101 CD109 is specifically expressed in endothelial cells of cutaneous cavernous haemangioma.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of CD109
25271095 expression increased in cutaneous squamous cell carcinoma
25149155 CD109 is highly expressed in TNBC and is a potential biomarker for the initiation, progression, and differentiation of breast cancer tumors.
24667143 CD109 plays a critical role in non-small-cell lung cancer (NSCLC) progression, and is overexpressed in advanced NSCLC
24396288 Hematopoietic cell marker CD109 is expressed in hepatic progenitor cells.
24376795 High expression of CD109 antigen regulates the phenotype of cancer stem-like cells/cancer-initiating cells in a novel epithelioid sarcoma cell line ESX and is related to poor prognosis of soft tissue sarcoma.
23509816 expression of CD109 (human platelet antigen 15) mRNA is different in various human cell types
22694813 The upregulation of CD109 protein in SSc may represent an adaptation or consequence of aberrant TGF-beta signaling in systemic sclerosis
21898545 CD109 is an important regulator of SMAD7/Smurf2-mediated degradation of TGFBR1.
21539622 CD109 release from the cell surface in human keratinocytes regulates TGF-beta receptor expression, TGF-beta signalling and STAT3 activation.
21295082 CD109 regulates TGF-beta receptor endocytosis and degradation to inhibit TGF-beta signaling.
20946523 These findings suggest that CD109 is involved in bladder tumorigenesis and is a potential target for cancer immunotherapy.
20667040 Observational study of genotype prevalence. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20101215 Processing of CD109 into 180 kDa and 25 kDa proteins by furin, followed by complex formation with the type I TGF-beta receptor is required for the regulation of TGF-beta signaling in cancer cells and keratinocytes.
20035377 Report PRSS3/mesotrypsin upregulation in breast cancer cells and identify CD109 as the functional proteolytic target of mesotrypsin.
19948007 Observational study of genotype prevalence. (HuGE Navigator)
19898481 Observational study of gene-disease association. (HuGE Navigator)
19570064 Observational study of genetic testing. (HuGE Navigator)
19016750 Up-regulation of CD109 expression is associated with carcinogensis of the squamous epithelium of the oral cavity.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17922683 CD109 expression may play a role in the development of lung squamous cell carcinoma.
17611685 the novel gene HEPT3 may function through its noncoding RNA and its overexpression may play a role in hepatocarcinogenesis [HEPT3]
17493171 Findings indicate that CD109 is a useful marker for the diagnosis of invasive breast and prostate carcinomas.
16959974 Found with a mutation in 7% of colon cancers studied.
16754747 CD109 plays a unique role in the regulation of isoform-specific TGF-beta signaling in keratinocytes.
15826242 Findings suggest that CD109 may become a molecular target for the development of new therapeutics for squamous cell carcinoma of various tissue origins.
15569238 Observational study of genotype prevalence. (HuGE Navigator)
11861285 A tyrosine703serine polymorphism of CD109 defines the Gov platelet alloantigens.
11861284 Cell surface antigen CD109 is a novel member of the alpha(2) macroglobulin/C3, C4, C5 family of thioester-containing proteins. cDNA sequence determination and protein structure analysis given.

AA Sequence

MQGPPLLTAAHLLCVCTAALAVAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKAELLKTASNLT      1 - 70
VSVLEAEGVFEKGSFKTLTLPSLPLNSADEIYELRVTGRTQDEILFSNSTRLSFETKRISVFIQTDKALY     71 - 140
KPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWLSQQSDLGVISKTFQLSSHPILGDWSIQVQV    141 - 210
NDQTYYQSFQVSEYVLPKFEVTLQTPLYCSMNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGKKKNI    211 - 280
TKTFKINGSANFSFNDEEMKNVMDSSNGLSEYLDLSSPGPVEILTTVTESVTGISRNVSTNVFFKQHDYI    281 - 350
IEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINY    351 - 420
TVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFKSPSKTYIQLKTRDENIKVGSPFELVVSGN    421 - 490
KRLKELSYMVVSRGQLVAVGKQNSTMFSLTPENSWTPKACVIVYYIEDDGEIISDVLKIPVQLVFKNKIK    491 - 560
LYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMENVVHELELYNTGYYLGMFMNSF    561 - 630
AVFQECGLWVLTDANLTKDYIDGVYDNAEYAERFMEENEGHIVDIHDFSLGSSPHVRKHFPETWIWLDTN    631 - 700
MGYRIYQEFEVTVPDSITSWVATGFVISEDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEITI    701 - 770
FNYLKDATEVKVIIEKSDKFDILMTSNEINATGHQQTLLVPSEDGATVLFPIRPTHLGEIPITVTALSPT    771 - 840
ASDAVTQMILVKAEGIEKSYSQSILLDLTDNRLQSTLKTLSFSFPPNTVTGSERVQITAIGDVLGPSING    841 - 910
LASLIRMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQGYQRELLYQREDGSFSAFGNY    911 - 980
DPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGHQKSNGEFWDPGRVIHSELQGGNKSPVTLTA    981 - 1050
YIVTSLLGYRKYQPNIDVQESIHFLESEFSRGISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQEGG   1051 - 1120
MQFWVSSESKLSDSWQPRSLDIEVAAYALLSHFLQFQTSEGIPIMRWLSRQRNSLGGFASTQDTTVALKA   1121 - 1190
LSEFAALMNTERTNIQVTVTGPSSPSPVKFLIDTHNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVV   1191 - 1260
YNVKASGSSRRRRSIQNQEAFDLDVAVKENKDDLNHVDLNVCTSFSGPGRSGMALMEVNLLSGFMVPSEA   1261 - 1330
ISLSETVKKVEYDHGKLNLYLDSVNETQFCVNIPAVRNFKVSNTQDASVSIVDYYEPRRQAVRSYNSEVK   1331 - 1400
LSSCDLCSDVQGCRPCEDGASGSHHHSSVIFIFCFKLLYFMELWL                            1401 - 1445
//

Text Mined References (57)

PMID Year Title
26707640 2016 CD109 is a component of exosome secreted from cultured cells.
26621871 2016 Soluble CD109 binds TGF-? and antagonizes TGF-? signalling and responses.
26249215 2015 CD109 is a novel marker for squamous cell/adenosquamous carcinomas of the gallbladder.
26122747 2015 Elevated Expression of CD109 in Esophageal Squamous Cell Carcinoma.
26031650 2015 Prognostic impact of CD109 expression in myxofibrosarcoma.
25787250 2015 Neomorphic effects of recurrent somatic mutations in Yin Yang 1 in insulin-producing adenomas.
25724945 2015 CD109 attenuates TGF-?1 signaling and enhances EGF signaling in SK-MG-1 human glioblastoma cells.
25506915 2014 A subpopulation of circulating endothelial cells express CD109 and is enriched in the blood of cancer patients.
25388101 2015 CD109 is specifically expressed in endothelial cells of cutaneous cavernous haemangioma.
25271095 2014 CD109 expression is increased in cutaneous squamous cell carcinoma.
25149155 2014 CD109 is a potential target for triple-negative breast cancer.
24667143 2014 SWATH™- and iTRAQ-based quantitative proteomic analyses reveal an overexpression and biological relevance of CD109 in advanced NSCLC.
24396288 2014 Human hepatic progenitor cells express hematopoietic cell markers CD45 and CD109.
24376795 2013 High expression of CD109 antigen regulates the phenotype of cancer stem-like cells/cancer-initiating cells in the novel epithelioid sarcoma cell line ESX and is related to poor prognosis of soft tissue sarcoma.
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23509816 2013 Human platelet antigen genotyping and expression of CD109 (human platelet antigen 15) mRNA in various human cell types.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22694813 2012 CD109, a TGF-? co-receptor, attenuates extracellular matrix production in scleroderma skin fibroblasts.
21898545 2012 CD109-mediated degradation of TGF-? receptors and inhibition of TGF-? responses involve regulation of SMAD7 and Smurf2 localization and function.
21539622 2011 CD109 release from the cell surface in human keratinocytes regulates TGF-? receptor expression, TGF-? signalling and STAT3 activation: relevance to psoriasis.
21295082 2011 The TGF-? co-receptor, CD109, promotes internalization and degradation of TGF-? receptors.
21269460 2011 Initial characterization of the human central proteome.
20946523 2010 Correlation of pathological grade and tumor stage of urothelial carcinomas with CD109 expression.
20667040 2010 The allele frequencies of HPA 1-16 determined by PCR-SSP in Chinese Cantonese donors.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20101215 2010 Processing of CD109 by furin and its role in the regulation of TGF-beta signaling.
20035377 2010 Mesotrypsin promotes malignant growth of breast cancer cells through shedding of CD109.
19948007 2010 Human platelet antigen polymorphisms (HPA-1, -2, -3, -4, -5 and -15) in major ethnic groups of Pakistan.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19570064 2009 Simultaneous genotyping of human platelet antigen-1 to 17w by polymerase chain reaction sequence-based typing.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19016750 2008 Up-regulation of CD109 expression is associated with carcinogenesis of the squamous epithelium of the oral cavity.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17922683 2007 High-level expression of CD109 is frequently detected in lung squamous cell carcinomas.
17611685 2007 Identification of a novel gene HEPT3 that is overexpressed in human hepatocellular carcinoma and may function through its noncoding RNA.
17493171 2007 CD109, a new marker for myoepithelial cells of mammary, salivary, and lacrimal glands and prostate basal cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16754747 2006 Identification of CD109 as part of the TGF-beta receptor system in human keratinocytes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
15826242 2005 CD109 expression in squamous cell carcinoma of the uterine cervix.
15569238 2004 Gene frequencies of the HPA-15 (Gov) platelet alloantigen system in Brazilians.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14980714 2004 CD109 represents a novel branch of the alpha2-macroglobulin/complement gene family.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12799300 2003 Antibody W7C5 defines a CD109 epitope expressed on CD34+ and CD34- hematopoietic and mesenchymal stem cell subsets.
11861285 2002 A tyrosine703serine polymorphism of CD109 defines the Gov platelet alloantigens.
11861284 2002 Cell surface antigen CD109 is a novel member of the alpha(2) macroglobulin/C3, C4, C5 family of thioester-containing proteins.
10972910 2000 Platelet and granulocyte glycoprotein polymorphisms.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
2346781 1990 Gova/b alloantigen system on human platelets.
1984805 1991 Identification of a cell-surface antigen associated with activated T lymphoblasts and activated platelets.