Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.85
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Burkitt Lymphoma 20 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 5.9e-09
ependymoma 4679 2.8e-08
osteosarcoma 7950 8.8e-05
group 3 medulloblastoma 4104 1.3e-03
cutaneous lupus erythematosus 1057 5.9e-03
lung cancer 4740 4.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Varicocele 26 3.56 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer -1.400 5.9e-09
cutaneous lupus erythematosus -1.100 5.9e-03
ependymoma 1.300 2.8e-08
group 3 medulloblastoma 1.100 1.3e-03
lung cancer -1.200 4.0e-02
osteosarcoma -1.810 8.8e-05

Synonym

Accession Q92526 B4DX20 B4DYB0 Q8TC34 TCP-1-zeta-2
Symbols Cctz2
CCTZ-2
TSA303
CCT-zeta-2
TCP-1-zeta-2

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MAAIKAVNSKAEVARARAALAVNICAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLDEMQIQ      1 - 70
HPTASLIAKVATAQDDVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAKIKALEVLEEVKVT     71 - 140
KEMKRKILLDVARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKLGTDTKLIQGL    141 - 210
VLDHGARHPDMKKRVEDAFILICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDK    211 - 280
VCAQSNKGFVVINQKGIDPFSLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLTVDCLGHAGLV    281 - 350
YEYTLGEEKFTFIEECVNPCSVTLLVKGPNKHTLTQVKDAIRDGLRAIKNAIEDGCMVPGAGAIEVAMAE    351 - 420
ALVTYKNSIKGRARLGVQAFADALLIIPKVLAQNAGYDPQETLVKVQAEHVESKQLVGVDLNTGEPMVAA    421 - 490
DAGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLK                                  491 - 530
//

Text Mined References (13)

PMID Year Title