Property Summary

NCBI Gene PubMed Count 24
PubMed Score 23.85
PubTator Score 11.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.214 1.9e-02
Multiple myeloma 1.949 6.5e-04
glioblastoma 1.600 7.6e-03
group 3 medulloblastoma 1.300 5.5e-04
medulloblastoma, large-cell 1.400 5.0e-05
acute quadriplegic myopathy 1.654 3.3e-07
non-small cell lung cancer 1.146 2.6e-21
colon cancer 1.200 3.2e-02
lung cancer 1.800 1.4e-05
breast carcinoma 1.700 7.1e-03
pediatric high grade glioma 1.200 4.7e-05
lung adenocarcinoma 1.107 2.8e-04
ovarian cancer 2.500 5.8e-05
Breast cancer 1.100 8.8e-05
dermatomyositis 1.300 2.3e-03

Gene RIF (2)

PMID Text
23166591 Expression of HIV-1 Tat upregulates the abundance of chaperonin containing TCP1, subunit 6A (CCT6A) in the nucleoli of Jurkat T-cells
16211299 identified genes, which include Tcp20, may play important role in conferring radioresistance to oral squamous cell carcinoma and could be useful in identifying cases with more radioresistance

AA Sequence

MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMQIQ      1 - 70
HPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEVKVS     71 - 140
REMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIRGL    141 - 210
VLDHGARHPDMKKRVEDAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRK    211 - 280
VCGDSDKGFVVINQKGIDPFSLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLV    281 - 350
YEYTLGEEKFTFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAE    351 - 420
ALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVDLNTGEPMVAA    421 - 490
EVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG                                 491 - 531
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23011926 2013 Human TRiC complex purified from HeLa cells contains all eight CCT subunits and is active in vitro.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20193073 2010 Chaperonin genes on the rise: new divergent classes and intense duplication in human and other vertebrate genomes.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18775504 2009 The CCT/TRiC chaperonin is required for maturation of sphingosine kinase 1.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16211299 2005 Identification of candidate radioresistant genes in human squamous cell carcinoma cells through gene expression analysis using DNA microarrays.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14532270 2003 A product of the human gene adjacent to parkin is a component of Lewy bodies and suppresses Pael receptor-induced cell death.
12853948 2003 The DNA sequence of human chromosome 7.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11532003 2001 Cytosolic chaperonin-containing t-complex polypeptide 1 changes the content of a particular subunit species concomitant with substrate binding and folding activities during the cell cycle.
10810232 Cloning of rabbit Cct6 and the distribution of the Cct complex in mammalian tissues.
8034610 1994 Tcp20, a subunit of the eukaryotic TRiC chaperonin from humans and yeast.
7953530 1994 Identification of six Tcp-1-related genes encoding divergent subunits of the TCP-1-containing chaperonin.
1602151 1992 Treatment of Haemophilus aphrophilus endocarditis with ciprofloxacin.
1352881 1992 Isolation of a gene encoding a chaperonin-like protein by complementation of yeast amino acid transport mutants with human cDNA.