Property Summary

NCBI Gene PubMed Count 30
PubMed Score 143.41
PubTator Score 56.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.202 2.9e-02
Multiple myeloma 2.575 9.8e-05
acute quadriplegic myopathy 1.509 2.8e-08
non-small cell lung cancer 1.034 8.4e-22
lung cancer 2.900 2.6e-04
colon cancer 1.200 5.9e-05
diabetes mellitus 2.100 1.3e-03
ductal carcinoma in situ 1.100 1.3e-03
invasive ductal carcinoma 1.300 1.9e-03
ovarian cancer 3.400 8.1e-07
dermatomyositis 1.100 4.3e-03

 MGI Phenotype (1)

Gene RIF (7)

PMID Text
26739059 Suggest that CCT3 is indispensible for hepatocellular carcinoma cell proliferation, and provides a potential drug target for treatment of HCC.
26229401 Overexpression of CCT3 in the nuclei of cancerous cells is associated with hepatocellular carcinoma progression. CCT3 may be a target that affects the activation of STAT3 in HCC.
23868055 Expression of S100A9 and CCTgamma was significantly elevated in liver tissue of patients with cholangiocarcinoma compared with controls.
22399500 Our results implicate a novel cell signaling loop in HCt116 cells involving p53 and TCP1-gamma phosphorylation, which may be related to regulation and action of centrosomes.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
12586295 Among ten hepatocellular carcinoma cases with amplicon 1q21-q22, significant gene expression level of JTB, SHC1, CCT3 and COPA in the tumors than the paired adjacent non-malignant liver tissues.

AA Sequence

MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREI      1 - 70
QVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKI     71 - 140
SIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIE    141 - 210
DSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCE    211 - 280
DIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLL    281 - 350
EIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH    351 - 420
ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDM    421 - 490
KELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQE                   491 - 545
//

Text Mined References (43)

PMID Year Title
26739059 2016 Molecular chaperone CCT3 supports proper mitotic progression and cell proliferation in hepatocellular carcinoma cells.
26229401 2015 Overexpression of chaperonin containing TCP1, subunit 3 predicts poor prognosis in hepatocellular carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24647736 2014 Multiple nonglycemic genomic loci are newly associated with blood level of glycated hemoglobin in East Asians.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23868055 2013 A prospective proteomic-based study for identifying potential biomarkers for the diagnosis of cholangiocarcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23011926 2013 Human TRiC complex purified from HeLa cells contains all eight CCT subunits and is active in vitro.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22399500 Proteomic identification of chaperonin-containing tail-less complex polypeptide-1 gamma subunit as a p53-responsive protein in colon cancer cells.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20193073 2010 Chaperonin genes on the rise: new divergent classes and intense duplication in human and other vertebrate genomes.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20080638 2010 BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18775504 2009 The CCT/TRiC chaperonin is required for maturation of sphingosine kinase 1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532270 2003 A product of the human gene adjacent to parkin is a component of Lewy bodies and suppresses Pael receptor-induced cell death.
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12586295 2003 Positional mapping for amplified DNA sequences on 1q21-q22 in hepatocellular carcinoma indicates candidate genes over-expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10635329 1999 Formation of the VHL-elongin BC tumor suppressor complex is mediated by the chaperonin TRiC.
8573069 1996 Cloning, structure and mRNA expression of human Cctg, which encodes the chaperonin subunit CCT gamma.
8110840 1994 cDNA encoding a novel TCP1-related protein.
8001976 1994 Assignment of the human homologue of the mTRiC-P5 gene (TRIC5) to band 1q23 by fluorescence in situ hybridization.
7953530 1994 Identification of six Tcp-1-related genes encoding divergent subunits of the TCP-1-containing chaperonin.