Property Summary

NCBI Gene PubMed Count 39
PubMed Score 26.83
PubTator Score 18.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.592 1.2e-02
Multiple myeloma 1.589 1.1e-03
psoriasis -1.700 1.7e-04
group 3 medulloblastoma 1.800 1.1e-02
glioblastoma 1.400 6.0e-03
non diabetic and post-ischemic heart fai... -1.100 3.2e-02
medulloblastoma, large-cell 1.400 4.4e-03
hereditary spastic paraplegia -1.032 1.5e-02
acute quadriplegic myopathy 1.512 5.2e-05
non-small cell lung cancer 1.241 7.8e-12
lung cancer 2.000 1.0e-04
Parkinson's disease -1.100 3.6e-02
atypical teratoid/rhabdoid tumor 1.200 8.8e-04
nasopharyngeal carcinoma 1.200 5.7e-03
lung adenocarcinoma 2.079 7.3e-06
invasive ductal carcinoma 1.200 1.4e-02
ovarian cancer 1.700 3.9e-03
Gaucher disease type 1 -1.100 8.8e-03
dermatomyositis 1.600 2.2e-04

Gene RIF (11)

PMID Text
25704758 A role for the TRiC subunits TCP1 and CCT2, and potentially the entire TRiC complex, in breast cancer.
24375412 PDCD5 bound the apical domain of the CCTbeta subunit, projecting above the folding cavity without entering it. Like PDCD5, beta-tubulin also interacts with the CCTbeta apical domain, but a second site is found at the sensor loop deep within the folding cavity.
23782473 Increased expression of CCT2 is associated with tumor progression and the clinical behavior of gallbladder carcinoma.
23190606 Destruction of the beta-tubulin:CCT-beta complex provokes Hsp90-dependent protein ubiquitination and degradation.
23166591 Tandem affinity purification and mass spectrometry analysis identify chaperonin containing TCP1 subunit 2 (CCT2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify chaperonin containing TCP1 subunit 2 (CCT2), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20573828 PB2 associates with CCT2 as a monomer and the CCT binding site is located in a central region of the PB2 protein.
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19332537 The chaperonin CCT is identified as a novel physiological substrate for p90 ribosomal S6 kinase (RSK) and p70 ribosomal S6 kinase (S6K).
18976975 Knockdown of chaperonin containing TCP1, subunit 2 (CCT2) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDASLMVTNDGATI      1 - 70
LKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWREATKAAREA     71 - 140
LLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLEAIHIIKKLGGSLA    141 - 210
DSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVE    211 - 280
RILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIE    281 - 350
EVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHA    351 - 420
VTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDMREGTIGDMAI    421 - 490
LGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC                             491 - 535
//

Text Mined References (52)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25704758 2015 Two members of the TRiC chaperonin complex, CCT2 and TCP1 are essential for survival of breast cancer cells and are linked to driving oncogenes.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
24375412 2014 Programmed cell death protein 5 interacts with the cytosolic chaperonin containing tailless complex polypeptide 1 (CCT) to regulate ?-tubulin folding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23782473 2013 Clinicopathological features and CCT2 and PDIA2 expression in gallbladder squamous/adenosquamous carcinoma and gallbladder adenocarcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23245942 2012 Role of TAZ as mediator of Wnt signaling.
23190606 2012 Targeting ?-tubulin:CCT-? complexes incurs Hsp90- and VCP-related protein degradation and induces ER stress-associated apoptosis by triggering capacitative Ca2+ entry, mitochondrial perturbation and caspase overactivation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23011926 2013 Human TRiC complex purified from HeLa cells contains all eight CCT subunits and is active in vitro.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22500027 2012 Intrinsic protein-protein interaction-mediated and chaperonin-assisted sequential assembly of stable bardet-biedl syndrome protein complex, the BBSome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21753002 2011 Parkin interacts with Ambra1 to induce mitophagy.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20573828 2010 Association of the influenza virus RNA polymerase subunit PB2 with the host chaperonin CCT.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20080638 2010 BBS6, BBS10, and BBS12 form a complex with CCT/TRiC family chaperonins and mediate BBSome assembly.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19332537 2009 p90 ribosomal S6 kinase and p70 ribosomal S6 kinase link phosphorylation of the eukaryotic chaperonin containing TCP-1 to growth factor, insulin, and nutrient signaling.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18775504 2009 The CCT/TRiC chaperonin is required for maturation of sphingosine kinase 1.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16541075 2006 The finished DNA sequence of human chromosome 12.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532270 2003 A product of the human gene adjacent to parkin is a component of Lewy bodies and suppresses Pael receptor-induced cell death.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11580269 2001 Point mutations in a hinge linking the small and large domains of beta-actin result in trapped folding intermediates bound to cytosolic chaperonin CCT.
11532003 2001 Cytosolic chaperonin-containing t-complex polypeptide 1 changes the content of a particular subunit species concomitant with substrate binding and folding activities during the cell cycle.
10748209 2000 Individual subunits of the eukaryotic cytosolic chaperonin mediate interactions with binding sites located on subdomains of beta-actin.
10404219 1999 3D reconstruction of the ATP-bound form of CCT reveals the asymmetric folding conformation of a type II chaperonin.
9819444 1998 Maturation of human cyclin E requires the function of eukaryotic chaperonin CCT.
7953530 1994 Identification of six Tcp-1-related genes encoding divergent subunits of the TCP-1-containing chaperonin.