Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.73
PubTator Score 3.37

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.400 3.4e-04
astrocytic glioma -1.100 1.5e-02
Astrocytoma, Pilocytic -1.400 9.4e-07
atypical teratoid / rhabdoid tumor -1.500 9.1e-05
ependymoma -1.100 3.4e-02
glioblastoma -1.500 1.2e-08
group 3 medulloblastoma 1.800 3.4e-03
lung adenocarcinoma 1.100 2.1e-08
lung carcinoma 3.000 4.5e-35
oligodendroglioma -1.100 2.1e-02

Protein-protein Interaction (2)

Gene RIF (3)

AA Sequence

MGDSGSRRSTLVSRLPIFRRSINRRHDSLPSSPSSSNTVGVHSSSPSSTNSSSGSTGKRRSIFRTPSISF      1 - 70
HHKKGSEPKQEPTNQNLSISNGAQPGHSNMQKLSLEEHIKTRGRHSVGFSSSRNKKITRSLTEDFEREKE     71 - 140
HSTNKNVFINCLSSGKSEGDDSGFTEDQTRRSVKQSTRKLLPKSFSSHYKFSKPVLQSQSISLVQQSEFS    141 - 210
LEVTQYQEREPVLVRASPSCSVDVTERAGSSLQSPLLSADLTTAQTPSEFLALTEDSVSEMDAFSKSGSM    211 - 280
ASHCDNFGHNDSTSQMSLNSAAVTKTTTELTGTVPCAIMSPGKYRLEGQCSTESNSLPETSAANQKEVLL    281 - 350
QIAELPATSVSHSESNLPADSEREENIGLQNGETMLGTNSPRKLGFYEQHKAIAEHVKGIHPISDSKIIP    351 - 420
TSGDHHIFNKTSHGYEANPAKVLASSLSPFREGRFIERRLRSSSEGTAGSSRMILKPKDGNIEEVNSLRK    421 - 490
QRAGSSSSKMNSLDVLNNLGSCELDEDDLMLDLEFLEEQSLHPSVCREDSYHSVVSCAAVVLTPMEPMIE    491 - 560
MKKREEPEFPEPSKQNLSLKLTKDVDQEARCSHISRMPNSPSADWPLQGVEENGGIDSLPFRLMLQDCTA    561 - 630
VKTLLLKMKRVLQESADMSPASSTTSLPVSPLTEEPVPFKDIMKDECSMLKLQLKEKDELISQLQEELGK    631 - 700
VRHLQKAFASRVDKSTQTELLCYDGLNLKRLETVQGGREATYRNRIVSQNLSTRDRKAIHTPTEDRFRYS    701 - 770
AADQTSPYKNKTCQLPSLCLSNFLKDKELAEVIKHSRGTYETLTSDVTQNLRATVGQSSLKPTAKTEGLS    771 - 840
TFLEKPKDQVATARQHSTFTGRFGQPPRGPISLHMYSRKNVFLHHNLHSTELQTLGQQDG              841 - 900
//

Text Mined References (15)

PMID Year Title