Property Summary

Ligand Count 88
NCBI Gene PubMed Count 59
PubMed Score 109.89
PubTator Score 105.71

Knowledge Summary

Patent (39,514)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hypersensitivity 63 0.0 0.0
Pneumonia 174 0.0 0.0
Status Epilepticus 98 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

Gene RIF (46)

AA Sequence

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVI      1 - 70
LVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCI     71 - 140
SVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKL    141 - 210
KSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTID    211 - 280
AYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRRE    281 - 350
GSLKLSSMLLETTSGALSL                                                       351 - 369
//

Text Mined References (59)

PMID Year Title