Property Summary

NCBI Gene PubMed Count 53
PubMed Score 105.04
PubTator Score 105.71

Knowledge Summary

Patent (39,514)

Expression

Protein-protein Interaction (4)

Gene RIF (40)

PMID Text
26879872 Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis.
26348893 CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue.
26279399 CCR9 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group.
26168791 CCR9 could be beneficial in predicting lymph node metastasis, and it might act as a novel prognostic biomarker for lung adenocarcinoma.
26006007 We also show that primary tumors can be modeled in immunocompetent mice by microinjecting CCR9-expressing cancer cell lines into early-stage mouse blastocysts, which induces central immune tolerance
25710912 activation of Notch1 has a dominant-negative effect on Ccr9 transcription and that Notch1 and E proteins control the dynamic expression of Ccr9 during T cell development.
25691296 CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway.
25296976 Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls.
24936795 High CCR9 expression is associated with the pathogenesis of ulcerative colitis.
24870448 The results show the potential of the 91R monoclonal antibody as a therapeutic agent for treatment of CCR9-expressing tumors.
24828696 CCR9 expression is elevated in the nodal lymphomas of patients with GI involvement
24606696 Only rotavirus specific CD4 T cells expressed intestinal homing receptors alpha4beta7 and CCR9.
24489825 HIV-1 Nef induces variable levels of CCR9 downregulation in different cell types
24481516 results suggest that CCR9 can act as a novel prognostic marker and therapeutic target for hepatocellular carcinoma
23333304 HIV-1 Nef induces variable levels of CCR9 downregulation in different cell types
23326330 Data suggest that P-glycoprotein associate with the F-actin cytoskeleton through ezrin/radixin/moesin (ERM) in CCR9/CCL25 induced multidrug resistance of acute T-lymphocytic leukemia (T-ALL) cells.
21984373 Notch1 regulates chemotaxis and proliferation by controlling the CC-chemokine receptors 5 and 9 in T cell acute lymphoblastic leukaemia.
21637913 We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes.
21511186 CCR9+ Th cells are a subset of IL-21-producing T helper cells that influence regional specification of autoimmune diseases that affect accessory organs of the digestive system
21344163 CCL25 enhanced the expression of MMP-1, -9, -11 and -13 active proteins by BrCa cells in a CCR9-dependent fashion.
21075690 The high fraction of circulating IgA+ and IgG+ B cells expressing CCR9 and CCR10 in the first months of life indicates activation of naive B cells in the gut, coinciding with bacterial colonization.
20947433 TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells.
20738854 CCR9 expression by monocytes is increased in rheumatoid arthritis
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20081876 over-expressed TECK interacts with CCR9 on the endometrial stromal cells in the endometriotic milieu, which may contribute to the onset and progression of endometriosis.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20036838 Studies indicate that D6 chemokine receptor(CCR-9) may act as scavenging decoys and are involved in clearance of chemokines.
19756884 Results demonstrate enhanced pancreatic intraepithelial neoplasia and pancreatic cancer cell proliferation with activation of CCR9 by its selective ligand CCL25
19525985 more active homing of CCR9-926AG T cells to Peyer's patches may produce changes in Ag presentation and result in increased incidence of skin graft vs. host disease.
19525985 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18245522 Functionally active CCR9 on melanoma cells facilitates metastasis to the small intestine which may explain high incidence of metastis to the small intestine.
18245518 CCR9 is expressed on human melanoma cells and participates in the enhanced motility of melanoma cells and is likely a "homing receptor" for melanoma to the small bowel.
17570212 CCR9 expression is reduced on epithelial and lamina propria T cells in untreated celiac disease. Down-regulation of CCR9 persists in intraepithelial T cells from well-treated patients. Possible ongoing immune activation preferentially within epithelium.
17205512 CCR9 overexpression is associated with Adult T-cell leukemia cells infiltrating gastrointestinal tract
15717282 involved in the pathogenesis of lymphatic filarial disease
15623660 High Expression of CCR9 is associated with prostate cancer cell migration and invasion
14559839 CCR9 selectively induced T-ALL CD4+ T-cell chemotaxis and adhesion.
12816994 A subset of CCR9+ T cells from normal donors has characteristics of mucosal T cells in terms of activated phenotype, proliferative response to anti-CD2 stimulation, a Th1 or Tr1 cytokine profile, and support for Ig production by cocultured B cells.

AA Sequence

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVI      1 - 70
LVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCI     71 - 140
SVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKL    141 - 210
KSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTID    211 - 280
AYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRRE    281 - 350
GSLKLSSMLLETTSGALSL                                                       351 - 369
//

Text Mined References (53)

PMID Year Title
26879872 2016 CCR9 in cancer: oncogenic role and therapeutic targeting.
26348893 2015 Differential Effects of Gut-Homing Molecules CC Chemokine Receptor 9 and Integrin-?7 during Acute Graft-versus-Host Disease of the Liver.
26279399 2015 Intracellular expression profile and clinical significance of the CCR9-CCL25 chemokine receptor complex in nasopharyngeal carcinoma.
26168791 2015 Expression of CC chemokine receptor 9 predicts poor prognosis in patients with lung adenocarcinoma.
26006007 2015 Comprehensive models of human primary and metastatic colorectal tumors in immunodeficient and immunocompetent mice by chemokine targeting.
25710912 2015 Repression of Ccr9 transcription in mouse T lymphocyte progenitors by the Notch signaling pathway.
25691296 2015 CCR9-CCL25 interaction suppresses apoptosis of lung cancer cells by activating the PI3K/Akt pathway.
25296976 2014 CCR9/CCL25 expression in non-small cell lung cancer correlates with aggressive disease and mediates key steps of metastasis.
24936795 2014 CCL25/CCR9 interactions regulate the function of iNKT cells in oxazolone-induced colitis in mice.
24870448 Antitumor effects of a monoclonal antibody to human CCR9 in leukemia cell xenografts.
24828696 2014 Strong expression of chemokine receptor CCR9 in diffuse large B-cell lymphoma and follicular lymphoma strongly correlates with gastrointestinal involvement.
24606696 2014 Circulating human rotavirus specific CD4 T cells identified with a class II tetramer express the intestinal homing receptors ?4?7 and CCR9.
24481516 2014 CCR9 as a prognostic marker and therapeutic target in hepatocellular carcinoma.
23326330 2013 Activated ERM protein plays a critical role in drug resistance of MOLT4 cells induced by CCL25.
21984373 2012 Notch1 regulates chemotaxis and proliferation by controlling the CC-chemokine receptors 5 and 9 in T cell acute lymphoblastic leukaemia.
21637913 2011 Expression and histopathological correlation of CCR9 and CCL25 in ovarian cancer.
21511186 2011 A subset of interleukin-21+ chemokine receptor CCR9+ T helper cells target accessory organs of the digestive system in autoimmunity.
21344163 2011 CCL25 mediates migration, invasion and matrix metalloproteinase expression by breast cancer cells in a CCR9-dependent fashion.
21075690 2011 Development of gut-homing receptors on circulating B cells during infancy.
20947433 2011 Toll-like receptor 2 induces mucosal homing receptor expression and IgA production by human B cells.
20738854 2010 Monocytes/macrophages express chemokine receptor CCR9 in rheumatoid arthritis and CCL25 stimulates their differentiation.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20081876 2010 Abnormal regulation of chemokine TECK and its receptor CCR9 in the endometriotic milieu is involved in pathogenesis of endometriosis by way of enhancing invasiveness of endometrial stromal cells.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20036838 2010 Chemokine patterning by glycosaminoglycans and interceptors.
19756884 2009 CC chemokine receptor 9 enhances proliferation in pancreatic intraepithelial neoplasia and pancreatic cancer cells.
19525985 2010 Donor single nucleotide polymorphism in the CCR9 gene affects the incidence of skin GVHD.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18308860 2008 CCL25 and CCL28 promote alpha4 beta7-integrin-dependent adhesion of lymphocytes to MAdCAM-1 under shear flow.
18245522 2008 Activation of CCR9/CCL25 in cutaneous melanoma mediates preferential metastasis to the small intestine.
18245518 2008 CCR9 homes metastatic melanoma cells to the small bowel.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17570212 2007 Reduced chemokine receptor 9 on intraepithelial lymphocytes in celiac disease suggests persistent epithelial activation.
17205512 2007 Expression of CCR9 in HTLV-1+ T cells and ATL cells expressing Tax.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15717282 2005 Chemokine receptors of T cells and of B cells in lymphatic filarial infection: a role for CCR9 in pathogenesis.
15623660 2004 Expression and functional role of CCR9 in prostate cancer cell migration and invasion.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14559839 2003 Selectively increased expression and functions of chemokine receptor CCR9 on CD4+ T cells from patients with T-cell lineage acute lymphocytic leukemia.
12816994 2003 CC chemokine receptor 9 expression defines a subset of peripheral blood lymphocytes with mucosal T cell phenotype and Th1 or T-regulatory 1 cytokine profile.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11046037 2000 The role of thymus-expressed chemokine and its receptor CCR9 on lymphocytes in the regional specialization of the mucosal immune system.
10974041 2000 Lymphocyte CC chemokine receptor 9 and epithelial thymus-expressed chemokine (TECK) expression distinguish the small intestinal immune compartment: Epithelial expression of tissue-specific chemokines as an organizing principle in regional immunity.
10702689 1999 Mapping of the CCXCR1, CX3CR1, CCBP2 and CCR9 genes to the CCR cluster within the 3p21.3 region of the human genome.
10640743 2000 CCR9A and CCR9B: two receptors for the chemokine CCL25/TECK/Ck beta-15 that differ in their sensitivities to ligand.
10602049 2000 The chemokine TECK is expressed by thymic and intestinal epithelial cells and attracts double- and single-positive thymocytes expressing the TECK receptor CCR9.
10544196 1999 Human G protein-coupled receptor GPR-9-6/CC chemokine receptor 9 is selectively expressed on intestinal homing T lymphocytes, mucosal lymphocytes, and thymocytes and is required for thymus-expressed chemokine-mediated chemotaxis.
10498628 1999 TECK, an efficacious chemoattractant for human thymocytes, uses GPR-9-6/CCR9 as a specific receptor.
10229797 1999 Cutting edge: identification of the orphan chemokine receptor GPR-9-6 as CCR9, the receptor for the chemokine TECK.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.