| Tchem | C-C chemokine receptor type 9 |
Receptor for chemokine SCYA25/TECK. Subsequently transduces a signal by increasing the intracellular calcium ions level. Alternative coreceptor with CD4 for HIV-1 infection.
The protein encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to the chemokine receptor gene cluster region. Two alternatively spliced transcript variants have been described. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
The protein encoded by this gene is a member of the beta chemokine receptor family. It is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. Chemokines and their receptors are key regulators of the thymocytes migration and maturation in normal and inflammation conditions. The specific ligand of this receptor is CCL25. It has been found that this gene is differentially expressed by T lymphocytes of small intestine and colon, suggested a role in the thymocytes recruitment and development that may permit functional specialization of immune responses in different segment of the gastrointestinal tract. This gene is mapped to the chemokine receptor gene cluster region. Two alternatively spliced transcript variants have been described. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
Comments
| Disease | Target Count |
|---|---|
| Hypersensitivity | 63 |
| Pneumonia | 133 |
| Status Epilepticus | 85 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Inflammatory bowel disease | 142 | 4.852 | 2.4 |
| Sclerosing cholangitis | 17 | 3.246 | 1.6 |
| CD45 deficiency | 3 | 3.049 | 1.5 |
CHEMBL3800351
pKi 7.00
CHEMBL3604477
pIC50 7.02
CHEMBL3815007
pIC50 7.03
CHEMBL3799853
pKi 7.04
CHEMBL3604478
pIC50 7.05
CHEMBL3799395
pKi 7.07
CHEMBL3814176
pIC50 7.07
CHEMBL3797948
pKi 7.11
CHEMBL3798577
pKi 7.11
CHEMBL3799220
pKi 7.13
CHEMBL3815051
pIC50 7.13
CHEMBL3800355
pKi 7.14
CHEMBL3814683
pIC50 7.16
CHEMBL3604496
pIC50 7.22
CHEMBL3799328
pKi 7.23
CHEMBL3798104
pKi 7.24
CHEMBL3798670
pKi 7.27
CHEMBL3604482
pIC50 7.28
CHEMBL3798206
pKi 7.29
CHEMBL3798681
pKi 7.35
| PMID | Text | |
|---|---|---|
| 26879872 | Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis. | |
| 26348893 | CCR9 and Integrin-beta7 expression has a differential effect on graft fate during acute graft-versus-host disease (GVHD) of the liver depending on the GVHD target tissue. | |
| 26279399 | CCR9 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group. | |
| 26168791 | CCR9 could be beneficial in predicting lymph node metastasis, and it might act as a novel prognostic biomarker for lung adenocarcinoma. | |
| 26006007 | We also show that primary tumors can be modeled in immunocompetent mice by microinjecting CCR9-expressing cancer cell lines into early-stage mouse blastocysts, which induces central immune tolerance | |
| 25710912 | activation of Notch1 has a dominant-negative effect on Ccr9 transcription and that Notch1 and E proteins control the dynamic expression of Ccr9 during T cell development. | |
| 25691296 | CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway. | |
| 25296976 | Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls. | |
| 24936795 | High CCR9 expression is associated with the pathogenesis of ulcerative colitis. | |
| 24870448 | The results show the potential of the 91R monoclonal antibody as a therapeutic agent for treatment of CCR9-expressing tumors. | |
| 24828696 | CCR9 expression is elevated in the nodal lymphomas of patients with GI involvement | |
| 24606696 | Only rotavirus specific CD4 T cells expressed intestinal homing receptors alpha4beta7 and CCR9. | |
| 24489825 | HIV-1 Nef induces variable levels of CCR9 downregulation in different cell types | |
| 24481516 | results suggest that CCR9 can act as a novel prognostic marker and therapeutic target for hepatocellular carcinoma | |
| 23333304 | HIV-1 Nef induces variable levels of CCR9 downregulation in different cell types | |
| 23326330 | Data suggest that P-glycoprotein associate with the F-actin cytoskeleton through ezrin/radixin/moesin (ERM) in CCR9/CCL25 induced multidrug resistance of acute T-lymphocytic leukemia (T-ALL) cells. | |
| 21984373 | Notch1 regulates chemotaxis and proliferation by controlling the CC-chemokine receptors 5 and 9 in T cell acute lymphoblastic leukaemia. | |
| 21637913 | We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes. | |
| 21511186 | CCR9+ Th cells are a subset of IL-21-producing T helper cells that influence regional specification of autoimmune diseases that affect accessory organs of the digestive system | |
| 21344163 | CCL25 enhanced the expression of MMP-1, -9, -11 and -13 active proteins by BrCa cells in a CCR9-dependent fashion. | |
| 21075690 | The high fraction of circulating IgA+ and IgG+ B cells expressing CCR9 and CCR10 in the first months of life indicates activation of naive B cells in the gut, coinciding with bacterial colonization. | |
| 20947433 | TLR2 ligands induce CCR9 and CCR10 expression by circulating B-cells and increase their chemotaxis. TLR2 stimulation also induced J chain and IgA production demonstrating the induction of mucosal-like antibody secreting cells. | |
| 20738854 | CCR9 expression by monocytes is increased in rheumatoid arthritis | |
| 20438785 | Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) | |
| 20406964 | Observational study of gene-disease association. (HuGE Navigator) | |
| 20081876 | over-expressed TECK interacts with CCR9 on the endometrial stromal cells in the endometriotic milieu, which may contribute to the onset and progression of endometriosis. | |
| 20056178 | Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) | |
| 20036838 | Studies indicate that D6 chemokine receptor(CCR-9) may act as scavenging decoys and are involved in clearance of chemokines. | |
| 19756884 | Results demonstrate enhanced pancreatic intraepithelial neoplasia and pancreatic cancer cell proliferation with activation of CCR9 by its selective ligand CCL25 | |
| 19525985 | more active homing of CCR9-926AG T cells to Peyer's patches may produce changes in Ag presentation and result in increased incidence of skin graft vs. host disease. | |
| 19525985 | Observational study of gene-disease association. (HuGE Navigator) | |
| 19423540 | Observational study of gene-disease association. (HuGE Navigator) | |
| 18245522 | Functionally active CCR9 on melanoma cells facilitates metastasis to the small intestine which may explain high incidence of metastis to the small intestine. | |
| 18245518 | CCR9 is expressed on human melanoma cells and participates in the enhanced motility of melanoma cells and is likely a "homing receptor" for melanoma to the small bowel. | |
| 17570212 | CCR9 expression is reduced on epithelial and lamina propria T cells in untreated celiac disease. Down-regulation of CCR9 persists in intraepithelial T cells from well-treated patients. Possible ongoing immune activation preferentially within epithelium. | |
| 17205512 | CCR9 overexpression is associated with Adult T-cell leukemia cells infiltrating gastrointestinal tract | |
| 15717282 | involved in the pathogenesis of lymphatic filarial disease | |
| 15623660 | High Expression of CCR9 is associated with prostate cancer cell migration and invasion | |
| 14559839 | CCR9 selectively induced T-ALL CD4+ T-cell chemotaxis and adhesion. | |
| 12816994 | A subset of CCR9+ T cells from normal donors has characteristics of mucosal T cells in terms of activated phenotype, proliferative response to anti-CD2 stimulation, a Th1 or Tr1 cytokine profile, and support for Ig production by cocultured B cells. |
MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVI 1 - 70 LVYWYCTRVKTMTDMFLLNLAIADLLFLVTLPFWAIAAADQWKFQTFMCKVVNSMYKMNFYSCVLLIMCI 71 - 140 SVDRYIAIAQAMRAHTWREKRLLYSKMVCFTIWVLAAALCIPEILYSQIKEESGIAICTMVYPSDESTKL 141 - 210 KSAVLTLKVILGFFLPFVVMACCYTIIIHTLIQAKKSSKHKALKVTITVLTVFVLSQFPYNCILLVQTID 211 - 280 AYAMFISNCAVSTNIDICFQVTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISQAQWVSFTRRE 281 - 350 GSLKLSSMLLETTSGALSL 351 - 369 //
| PMID | Year | Title | |
|---|---|---|---|
| 26879872 | 2016 | CCR9 in cancer: oncogenic role and therapeutic targeting. | |
| 26348893 | 2015 | Differential Effects of Gut-Homing Molecules CC Chemokine Receptor 9 and Integrin-?7 during Acute Graft-versus-Host Disease of the Liver. | |
| 26279399 | 2015 | Intracellular expression profile and clinical significance of the CCR9-CCL25 chemokine receptor complex in nasopharyngeal carcinoma. | |
| 26168791 | 2015 | Expression of CC chemokine receptor 9 predicts poor prognosis in patients with lung adenocarcinoma. | |
| 26006007 | 2015 | Comprehensive models of human primary and metastatic colorectal tumors in immunodeficient and immunocompetent mice by chemokine targeting. | |
| 25710912 | 2015 | Repression of Ccr9 transcription in mouse T lymphocyte progenitors by the Notch signaling pathway. | |
| 25691296 | 2015 | CCR9-CCL25 interaction suppresses apoptosis of lung cancer cells by activating the PI3K/Akt pathway. | |
| 25296976 | 2014 | CCR9/CCL25 expression in non-small cell lung cancer correlates with aggressive disease and mediates key steps of metastasis. | |
| 24936795 | 2014 | CCL25/CCR9 interactions regulate the function of iNKT cells in oxazolone-induced colitis in mice. | |
| 24870448 | Antitumor effects of a monoclonal antibody to human CCR9 in leukemia cell xenografts. | ||
| 24828696 | 2014 | Strong expression of chemokine receptor CCR9 in diffuse large B-cell lymphoma and follicular lymphoma strongly correlates with gastrointestinal involvement. | |
| 24606696 | 2014 | Circulating human rotavirus specific CD4 T cells identified with a class II tetramer express the intestinal homing receptors ?4?7 and CCR9. | |
| 24481516 | 2014 | CCR9 as a prognostic marker and therapeutic target in hepatocellular carcinoma. | |
| 23326330 | 2013 | Activated ERM protein plays a critical role in drug resistance of MOLT4 cells induced by CCL25. | |
| 21984373 | 2012 | Notch1 regulates chemotaxis and proliferation by controlling the CC-chemokine receptors 5 and 9 in T cell acute lymphoblastic leukaemia. | |
| 21637913 | 2011 | Expression and histopathological correlation of CCR9 and CCL25 in ovarian cancer. | |
| 21511186 | 2011 | A subset of interleukin-21+ chemokine receptor CCR9+ T helper cells target accessory organs of the digestive system in autoimmunity. | |
| 21344163 | 2011 | CCL25 mediates migration, invasion and matrix metalloproteinase expression by breast cancer cells in a CCR9-dependent fashion. | |
| 21075690 | 2011 | Development of gut-homing receptors on circulating B cells during infancy. | |
| 20947433 | 2011 | Toll-like receptor 2 induces mucosal homing receptor expression and IgA production by human B cells. | |
| 20738854 | 2010 | Monocytes/macrophages express chemokine receptor CCR9 in rheumatoid arthritis and CCL25 stimulates their differentiation. | |
| 20438785 | 2010 | Polymorphisms in innate immunity genes and risk of childhood leukemia. | |
| 20406964 | 2010 | Risk of meningioma and common variation in genes related to innate immunity. | |
| 20190752 | 2010 | Multiple common variants for celiac disease influencing immune gene expression. | |
| 20081876 | 2010 | Abnormal regulation of chemokine TECK and its receptor CCR9 in the endometriotic milieu is involved in pathogenesis of endometriosis by way of enhancing invasiveness of endometrial stromal cells. | |
| 20056178 | 2010 | Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment. | |
| 20036838 | 2010 | Chemokine patterning by glycosaminoglycans and interceptors. | |
| 19756884 | 2009 | CC chemokine receptor 9 enhances proliferation in pancreatic intraepithelial neoplasia and pancreatic cancer cells. | |
| 19525985 | 2010 | Donor single nucleotide polymorphism in the CCR9 gene affects the incidence of skin GVHD. | |
| 19423540 | 2009 | Common variation in genes related to innate immunity and risk of adult glioma. | |
| 18577758 | 2008 | Dissociation of heterotrimeric g proteins in cells. | |
| 18308860 | 2008 | CCL25 and CCL28 promote alpha4 beta7-integrin-dependent adhesion of lymphocytes to MAdCAM-1 under shear flow. | |
| 18245522 | 2008 | Activation of CCR9/CCL25 in cutaneous melanoma mediates preferential metastasis to the small intestine. | |
| 18245518 | 2008 | CCR9 homes metastatic melanoma cells to the small bowel. | |
| 18240029 | 2008 | Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors. | |
| 17570212 | 2007 | Reduced chemokine receptor 9 on intraepithelial lymphocytes in celiac disease suggests persistent epithelial activation. | |
| 17205512 | 2007 | Expression of CCR9 in HTLV-1+ T cells and ATL cells expressing Tax. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15717282 | 2005 | Chemokine receptors of T cells and of B cells in lymphatic filarial infection: a role for CCR9 in pathogenesis. | |
| 15623660 | 2004 | Expression and functional role of CCR9 in prostate cancer cell migration and invasion. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14559839 | 2003 | Selectively increased expression and functions of chemokine receptor CCR9 on CD4+ T cells from patients with T-cell lineage acute lymphocytic leukemia. | |
| 12816994 | 2003 | CC chemokine receptor 9 expression defines a subset of peripheral blood lymphocytes with mucosal T cell phenotype and Th1 or T-regulatory 1 cytokine profile. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11046037 | 2000 | The role of thymus-expressed chemokine and its receptor CCR9 on lymphocytes in the regional specialization of the mucosal immune system. | |
| 10974041 | 2000 | Lymphocyte CC chemokine receptor 9 and epithelial thymus-expressed chemokine (TECK) expression distinguish the small intestinal immune compartment: Epithelial expression of tissue-specific chemokines as an organizing principle in regional immunity. | |
| 10702689 | 1999 | Mapping of the CCXCR1, CX3CR1, CCBP2 and CCR9 genes to the CCR cluster within the 3p21.3 region of the human genome. | |
| 10640743 | 2000 | CCR9A and CCR9B: two receptors for the chemokine CCL25/TECK/Ck beta-15 that differ in their sensitivities to ligand. | |
| 10602049 | 2000 | The chemokine TECK is expressed by thymic and intestinal epithelial cells and attracts double- and single-positive thymocytes expressing the TECK receptor CCR9. | |
| 10544196 | 1999 | Human G protein-coupled receptor GPR-9-6/CC chemokine receptor 9 is selectively expressed on intestinal homing T lymphocytes, mucosal lymphocytes, and thymocytes and is required for thymus-expressed chemokine-mediated chemotaxis. | |
| 10498628 | 1999 | TECK, an efficacious chemoattractant for human thymocytes, uses GPR-9-6/CCR9 as a specific receptor. | |
| 10229797 | 1999 | Cutting edge: identification of the orphan chemokine receptor GPR-9-6 as CCR9, the receptor for the chemokine TECK. | |
| 2834384 | 1988 | Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs. |
