Property Summary

NCBI Gene PubMed Count 148
PubMed Score 58.06
PubTator Score 250.18

Knowledge Summary

Patent (40,596)

Expression

Protein-protein Interaction (248)

GNAT3   GRM8   CORT   CCL21   CXCL11   GRM6   CCL25   CCL16   ADCY6   GALR2   CXCL13   ADCY3   ADCY9   GALR3   GABBR2   S1PR2   ADCY5   S1PR4   C3   C5   KNG1   POMC   PENK   PDYN   PPY   NPY   PPBP   PF4   CXCL10   GNAI2   APP   GNAI3   CXCL1   SAA1   ADORA3   PYY   CXCL8   CCL5   DRD2   ADRA2C   GNAZ   CXCL2   CXCL3   PMCH   S1PR1   FPR1   DRD4   GAL   CXCR1   CXCR2   FPR3   FPR2   ACKR3   NPY1R   SSTR1   SSTR2   SSTR4   CCR7   CXCR5   SSTR3   SSTR5   OPRM1   DRD3   ADCY8   OPRD1   OPRK1   OPRL1   CCR2   CXCL5   PTGER3   CCR10   GALR1   MTNR1A   CXCL12   NPBWR1   NPBWR2   NMU   PIK3CG   HCAR3   NPY2R   MTNR1B   CXCR3   NPY4R   P2RY4   CCR8   CCR9   ADCY7   CCL23   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   DEFB1   CXCR4   SST   GNB1   GNAI1   CCL20   CXCL6   DEFB103B   PLCB2   PLCB3   GNA12   CXCL9   ADCY2   ADCY1   GPR17   PNOC   GPR18   GNA13   GRM2   GRM7   GRM3   GRM4   P2RY14   NPY5R   NMS   PIK3R6   TAS2R42   MT-RNR2   NPW   ADCY4   NPB   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   LPAR1   ARHGEF1   MCHR2   OXGR1   S1PR3   GPER1   MCHR1   CCL19   P2RY13   SUCNR1   HCAR1   NMUR2   LPAR5   S1PR5   P2RY12   CXCL16   HRH4   NMUR1   LPAR2   PLCB1   CCL28   HEBP1   RXFP3   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   GABBR1   LPAR3   GPR55   CCL27   HRH3   INSL5   PTGDR2   LMBR1   YIF1B   ATP12A   LMBRD2   ITPR3   ITPR2   ATP2B4   ATP2B2   TMEM87A   RRAGC   SLC9A1   KIAA2013   ABCB1   MCOLN3   SLC4A2   ATP8B2   SPPL2B   SACM1L   PODXL   GOLGA5   HMGCR   SLC30A5   PIGU   TMEM161B   HM13   IPO11   RINT1   POMT2   ATP2C1   RMND1   PIGN   FITM2   ZDHHC13   ATP5F1   SLC39A10   GPR89A   ALG10   ERMP1   TVP23C   MCOLN1   FUT8   NDUFB3   ATP13A3   SLC19A2   MRS2   CERS6   RRAGB   LPCAT3   CHPT1   MT-ND4   FAM32A   SERINC1   CERS5   ATP9A   TMEM63A   C1orf112   TMEM184B   DYM   LCLAT1   RNF170   VEZT   CMTM6   TSPAN3   ALG3   LNPK   DERL2   YIPF3   DOLK  

MLP Assay (9)

AID Type Active / Inconclusive / Inactive Description
493098 screening 1656 / 0 / 339273 uHTS identification of small molecule antagonists of the CCR6 receptor via a luminescent beta-arrestin assay
493121 summary 0 / 0 / 0 Summary assay for selective small molecule antagonists of the CCR6 receptor
493159 summary 0 / 0 / 0 Summary assay for small molecule antagonists of the CCR6 receptor
504728 confirmatory 58 / 0 / 225 Dose Response confirmation of small molecule antagonists of the CCR6 receptor: a luminescent beta-arrestin assay
540334 confirmatory 13 / 0 / 6 SAR analysis of small molecule antagonists of the CCR6 receptor: a luminescent beta-arrestin assay
624129 confirmatory 15 / 0 / 595 Dose Response confirmation of uHTS hits from a small molecule antagonists of the CXCR6 receptor in a screening assay
651601 confirmatory 1 / 0 / 5 SAR analysis of small molecule antagonists of the CXCR6 receptor in a screening panel assay
651708 confirmatory 7 / 0 / 28 SAR analysis of small molecule antagonists of the CXCR6 receptor in a screening panel assay - 3
651941 confirmatory 0 / 0 / 9 SAR analysis of small molecule antagonists of the CXCR6 receptor using a CCR6 receptor luminescent beta-arrestin counterscreen

Gene RIF (123)

PMID Text
26536229 High CCR6 expression is associated with Inflammatory Bowel Disease.
26345847 Tregs of unexplained recurrent miscarriage patients was significantly lower than that in controls. CCL20-CCR6 could drive immune activity of CD4(+)FOXP3(+) Tregs, followed by their migration to the feto-maternal microenvironment
26314374 CCR6 SNPs are a risk factor for presence of anti-topoisomerase I antibodies in systemic sclerosis.
26156805 AEG-1 mediates CCL20/CCR6-induced EMT development via both Erk1/2 and Akt signaling pathway in cervical cancer, which indicates that CCL20/CCR6-AEG-1-EMT pathway could be suggested as a useful target to affect the progression of cervical cancer.
26138531 the current data demonstrate a genetic association between CCR6 variants and susceptibility to lupus nephritis
26125463 Leukocytes expressing CCR6 are present in the ovary immediately prior to ovulation.
25928629 RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population
25879557 The data reviewed suggest the necessity of evaluation of other blood redox-balance and nitric oxide in psoriasis should with additional investigations to targeting CCR6 rs3093024 in the genetic susceptibility of psoriasis.
25833398 PLZF regulates CCR6 and is critical for the acquisition and maintenance of the Th17 phenotype in human cells.
25768730 Th17 cells are recruited into tumor tissues preferentially through CCR6-CCL20 pathway
25698534 The involvement of cell surface nucleolin in the initiation of CCR6 signaling in human hepatocellular carcinoma.Expression of nucleolin and CCR6 correlates with overall survival in hepatocellular carcinoma patients.
25690781 Late-onset cytomegalovirus infection was preceded by an immune phenotype characterized by increased CCR6 expression on bulk CD4(+) T cells following solid organ transplant.
25661365 CCL20 cooperated with CCR6 could recruit T regulatory cells to tumor sites, and chemotherapy medicine docetaxel could decrease the expression of CCL20.
25541254 hBD-3 stimulates IL-37 expression through CCR6 in keratinocytes
25408215 The data of this study suggested that CCR6 expression, which shows an increase in both moderatesevere and mild Alaheimer disease patients, is related to the pathological process underlying Alzaheimer disease.
25201147 These findings support the hypothesis that CCR6 up-regulation stimulated by IL-17 may play an active role in colorectal cancer cell migration.
25178112 The different groups of clinically stable nonallergic asthmatic patients showed distinct patterns of alterations in subset distribution as well as CCR6, CXCR3, and CCR5 expression on circulating T lymphocytes.
24984269 CCR6 is highly expressed in thyroid cancer cells.CCR6 promotes the invasion and migration of thyroid cancer cells via NF-kappa B signaling-induced MMP-3 production.
24980635 CKR-L3 with other minor coreceptors may contribute to HIV and SIV pathogenesis including dissemination, trafficking and latency especially when major coreceptors become compromised.
24979261 The tumor expression of CCR6 plays a critical role in colorectal cancer metastasis.
24958901 CCR6+ naive precursors contain a predetermined reservoir to replenish IL-17-secreting cells and may have implications in balancing the Th17 effector and IL-17+ Treg compartments that are perturbed during HIV infection.
24890729 interfering with IL-1beta and IL-12 signaling in Th17 cells during inflammation may be a promising therapeutic approach to reduce their differentiation into "pathogenic" CCR6+ CXCR3+ Th1/17 cells in patients with autoimmune diseases.
24866282 High CCR6 expression is associated with colon cancer.
24782177 DPP4, CDK5RAP2, and CCR6 are risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans.
24743888 CCR6/CCL20 biological axis increased the capacity of proliferation and adhesion, as well as the chemotactic migration and the level of cytokines related to degraded extracellular matrix.
24634224 CCR6 protein level was higher in hepatocellular carcinoma (HCC) than in adjacent noncancerous tissues. CCR6 expression correlated with multicentricity and vascular invasion. CCR6 expression was an independent prognostic factor for overall survival.
24559209 CCR6 expression is regulated by miR-518a-5p in colorectal cancer cells.
24401998 Dendritic and T cells in psoriasis express CCL20 and CCR6 as part of the pathology.
24394994 genetic and biological role of the C-C chemokine ligand CCL20 and the C-C chemokine receptor CCR6in rheumatoid arthritis, is discussed.[review]
24385540 MicroRNA-150 inhibits tumor invasion and metastasis by targeting the chemokine receptor CCR6, in advanced cutaneous T-cell lymphoma.
24162774 HIV-1 gp120 upregulates the expression of chemokine (C-C motif) receptor 6 (CCR6) in human B cells
23983073 The results of this study establish CCR6 as a new susceptibility factor for antitopoisomerase-positive SSc, confirming the notion that systemic sclerosis and rheumatoid arthritis could conceivably share autoimmune risk alleles.
23959575 Chemokine receptor CCR6-dependent accumulation of gammadelta T cells in injured liver restricts hepatic inflammation and fibrosis.
23935994 This study was designed to determine the association of CCR6 and FGFR10P (tag)single nucleotide polymorphisms with Vogt-Koyanagi-Harada (VKH) syndrome, in two independent Chinese Han populations.
23835793 High CCR6/CCR7 expression and Foxp3 positive T regulatory cell number are positively related to the progression of laryngeal squamous cell carcinoma
23790181 results strongly suggest an association between CCL20/CCR6 expression and the induction of colorectal adenoma, colorectal adenocarcinoma and the development of colorectal liver metastases
23765988 some of the physiological reactions mediated by CCR6 ligands in male reproduction extend beyond a pro-inflammatory response and might find application in clinical reproduction and/or contraception.
23758411 CCR6 and CXCR2 were higher in the colorectal metastasis group than in the non-metastasis group, but there was no difference between the lung and liver metastasis subgroups. CXCR4 was not different between the metastasis and non-metastasis groups.
23681234 results suggest that plasmin generated in inflamed tissues might elicit production of chemokine CCL20 by human macrophages leading to the recruitment of CCR6 positive Th17 cells to the inflammatory sites
23599932 CD161high CCR6+ gammadelta T cells contribute to the inflammatory process in the central nervous system of multiple sclerosis patients.
23306142 Results suggest that the CCR6 rs3093024 polymorphism may not play a relevant role in the giant cell arteritis pathophysiology
22926920 Our data suggest for the first time that CCL20 and CCR6 might play an important role in the regulation of aggressiveness in human gliomas
22859539 study found a significant association between the genotype of CCR6 (rs3093024) and the susceptibility to rheumatoid arthritis in a Taiwanese population
22842622 HIV-1 gp120 upregulates the expression of chemokine (C-C motif) receptor 6 (CCR6) in human B cells
22796894 CXCR3 promotes recruitment of Th17 cells from the blood into the liver in both human and murine liver injury. Their subsequent positioning near bile ducts is dependent on CCR6 and cholangiocyte-secreted CCL20.
22732549 Review: Studies using the ApoE knockout mouse model have recently implicated chemokine receptor Ccr6 and its ligand Ccl20 as a nonredundant ligand-receptor pair in atherosclerosis.
22527137 A CCR6 variant strongly associated with rheumatoid arthritis in two populations is not associated with ankylosing spondylitis.
22490506 Increased expression of CCR6 is found in memory T-cells from Wegener's granulomatosis patients with polyangiitis.
22269120 Data indicate that JAK2 rs10758669 and CCR6 rs2301436 did not prove to be significant risk factors for both Crohn's disease (CD) and ulcerative colitis (UC).
22092173 CCR6 polymorphism was a risk factor for rheumatoid arthritis among asian females but a protective factor among asian males.
22079021 The data supported a role for CCR5, CXCR3, and CXCR6 in the selective recruitment of T cells into renal cell carcinoma tissue and, together with CCR6, in the recruitment of regulatory T cells.
21984702 A novel population of transgenic, CCR6-expressing, gammadelta-low expressing T cells is recruited to epidermal keratinocytes upon treatment with IL-23.
21949768 The role of the CCL20/CCR6/IL-17 axis in non-small-cell-lung-cancer tumor growth, was investigated.
21937703 unlike blood plasmacytoid dendritic cells (pDCs), a subset of tonsil pDCs express functional CCR6 and CCR10, and their respective ligands CCL20 and CCL27 are detected in inflamed epithelia
21935436 The CCL20-CCR6 axis mediates the migration of circulating Tregs into tumor microenvironment, which in turn results in tumor progression and poor prognosis in HCC patients.
21912453 Data show that both CCL20 and CCR6 mRNA and protein expression levels were significantly increased in patients who received preoperative FOLFOX chemotherapy </= 12 mo before liver surgery in comparison to patients who did not undergo FOLFOX treatment.
21873313 The tested CCR6 gene polymorphisms are not associated with the susceptibility to Behcet's disease in the tested Chinese Han populations.
21763254 CCR6 SNPs can be used to predict clinical outcome, and that polymorphisms in the CCR6 gene may influence T cell-mediated immune reactions after HSCT.
21724701 CCL20/CCR6 may play an important role in the pathogenesis of rheumatoid arthritis by assembling the molecular and cellular components orchestrating synovitis.
21624121 These results suggest a contribution of CCR6 expression on tumor cells and CCL19-expressing DC in breast cancer dissemination.
21398606 Data show that integrin beta7 and CCR6 identify four distinct stages of memory CD4+ T cell differentiation.
21300824 CCL20 induces MUC5AC mucin production via CCR6- and tumor necrosis factor (TNF)-alpha-converting enzyme (TACE)-dependent epidermal growth factor receptor (EGFR) activation in human airway epithelial (NCI-H292) cells.
21261017 CCR6 and CCR7 are expressed in metastatic lymph nodes and PBMC, and might play a role in laryngeal squamous cell carcinoma development.
21228329 we have identified a noncoding region of the human CCR6 gene with methylation-sensitive transcriptional activity in CCR6(+) T cells that controls stable CCR6 expression via epigenetic mechanisms.
21092675 The relative expression levels of CCR6 and CCR7 mRNA in tumor tissues with lymphatic metastases were significantly lower than those without lymph node metastases.
21072187 Observational study of gene-disease association. (HuGE Navigator)
20872189 Down-regulation of CCR6 is associated with adenocarcinoma of the lung.
20720211 Transgenic CCR6 expression characterizes a Foxp3-positive regulatory T-cell population that can be induced in mucosal tissues, that produces IL-10, and that traffics to inflamed colonic tissue to suppress ongoing inflammation of the colon.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20526340 Observational study of gene-disease association. (HuGE Navigator)
20526339 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20511548 Under inflammatory conditions, mesenchymal stem cells mediate adhesion of T helper (Th)17 cells via CCR6 and exert anti-inflammatory effects through induction of a T cell regulatory phenotype in these cells.
20483750 human beta-defensin (hBD)2 and 3 are chemotactic for a broad spectrum of leukocytes in a CCR6- and CCR2-dependent manner
20459729 CCL20 and CCR6 play a role in the development and progression of pancreatic cancer and may constitute potential targets for novel treatment strategies.
20453842 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20453841 The CCR6DNP genotype was correlated with the expression level of CCR6 and was associated with the presence of interleukin-17 (IL-17) in the sera of subjects with rheumatoid arthritis
20453841 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20439195 We studied a unique cohort of 21 primary lung cancers with matched adrenal metastases for the expression of CX3CR1, CXCR4, CCR6, and CCR7
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20334681 We suggest that CCR4 and CCR6 expression on CD4(+) T cells should be considered as markers of disease activity in systemic lupus erythematosus.
20220766 CCR6 is expressed at higher levels in plasmacytoid dendritic cells from melanoma patients compared to healthy controls. CCR6 may have a role in these cells' migration to tumor sites where CCL20 is produced.
20194631 CCR6 positive memory T cells producea suppressive IL-10 but not IL-2 upon stimulation with autologous immature dendritic cells.
20068036 Data show that recombinant mBD4:Ig and hBD2:Ig fusion proteins retained potent antimicrobial activity against Gram-negative and Gram-positive bacteria, and that these fusion proteins showed specific binding to CCR6-expressing cells.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20023216 CCR6 ligands inhibit HIV by inducing APOBEC3G.
20023216 CCR6 mediates induction APOBEC3G expression, resulting in inhibition of HIV infection in highly susceptible CCR6+ cells
20022113 Isoleucine/leucine in the N-terminal alpha-helix region of this beta-defensin is essential for CCR6-mediated chemotaxis.
19811428 Data show that number of peripheral Th17 lymphocytes, expression of CCR6 on Th cells, and ex vivo IL-23, anti-CD3 and anti-CD28 induced production of IL-22 by PBMC were significantly elevated in asthmatic patients.
19760754 Observational study of gene-disease association. (HuGE Navigator)
19539215 Recombinant human granulocyte colony-stimulating factor significantly decreases the expression of CXCR3 and CCR6 on T cells and preferentially induces T helper cells to a T helper 17 phenotype in peripheral blood harvests
19492413 This study demonstrates a different expression of CCL20-positive osteoblasts in osteoarthritis versus rheumatoid arthritis disease that seem to be associated with the presence of infiltrating mononuclear cells.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19324905 KSHV and K13-mediated induction of CCL20 and CCR6 may contribute to the recruitment of dendritic cells and lymphocytes into the KS lesions, and to tumor growth and metastases.
19305396 the CCR6-CCL20 axis in the choroid plexus controls immune surveillance of the CNS.
19249008 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19233848 CCR6 regulation of the actin cytoskeleton orchestrates human beta defensin-2- and CCL20-mediated restitution of colonic epithelial cells
18703490 CCL6 is overexpressed in myeloma microenvironment related to osteolytic bone lesions.
18465142 Expression levels of CCR6 in prostate cancer are associated with clinical and pathologic features of more advanced and aggressive prostate cancer.
18218038 Observational study of gene-disease association. (HuGE Navigator)
18097022 All IL-17-producing CD4+ T cells expressed CCR6, a receptor found on approximately 50% of CD4+ memory peripheral blood leukocytes.
17615381 T cells expressing CCR6, CXCR3, and CXCR6 act coordinately with respective ligands and Th1 inflammatory cytokines in the alveolitic/granuloma phases of the disease.
17562763 Interaction between CCL20 and CCR6 may play a role in chemokine-mediated lymphocyte trafficking during gastric inflammation in Helicobacter infection.
17171755 CCR6-expressing CD8+ T cells have the ability to migrate in response to CCL20, may migrate to tissues such as colon, and are involved in mucosal immunity.
17133360 Our results add new insight to the important role of the CCL20/CCR6, RANKL system in the bone tissue of rheumatoid arthritis.
17075975 CXCR4 expression in colorectal liver metastases suggests it is a predictive factor. CCL20 and receptor CCR6 expression in hepatocellular carcinomas indicates a role of a CCL20/CCR6 ligand-receptor pair in liver carcinogenesis and progression.
16641550 Findings strongly suggest an association between CCL20/CCR6 expression in human colorectal cancer and the promotion of colorectal liver metastasis.
16622267 association between expression level of CCR6 in primary CRC and synchronous liver metastases suggests that CCR6 and its ligand may be involved in the metastatic spread to the liver
16215992 CCR6 mediated signals result in increased IEC migration and proliferation suggesting an important role in intestinal homeostasis and intestinal inflammation by mediating chemotaxis of IEC but also in mediating migration of CRC cells.
16095490 MIP-3alpha/CCL20 has a role in amplification of the immune response during renal allograft rejection by attraction of CCR6+ inflammatory cells, which may include DC, to the site of inflammation
15972662 HIV-1 gp120 upregulates the expression of chemokine (C-C motif) receptor 6 (CCR6) in human B cells
15701269 We hypothesize that Mip-3alpha and its CCR6 receptor promote pancreatic cancer cell invasion
15591779 CCR6 has multiple domains involved in ligand binding and receptor signaling
15483227 CCR6 on polarized intestinal epithelial cells, alter specialized intestinal epithelial cell functions, including electrogenic ion secretion and possibly epithelial cell adhesion and migration
12642342 Coincident expression of CCR6 and CCR7 by pathologic Langerhans cells in Langerhans cell histiocytosis may contribute to their accumulation in nonlymphoid organs such as skin and bone
12514792 characterized the expression of CCR6 on B cells and B-cell non-Hodgkin's lymphomas
12193700 Clustering of CCR6 and coassociation with critical integrins such as CD18/beta2 integrin serve to strengthen adhesion between T cells and activated dermal microvascular endothelial cells in vitro.
12081481 Mutating the four extracellular cysteines reveals their differing roles in receptor trafficking, ligand binding, and signaling.
12070001 CCR1, CCR6, and CXCR6 are preferentially expressed by the low cytokine-producing CD8 and CD4(-)CD8(-) subsets of natural killer T-cells.
12067311 CCR6, appears to have an important role in the selective recruitment of T cells, in the context of periodontal inflammation.
11994436 CCR6 preferentially attracts memory B cells and becomes an efficacious B-cell receptor following cellular activation, acquiring an enhanced function due to changes in the responsiveness of downstream signaling pathways.
11751947 Up-regulation on distinct subpopulations of antigen-activated CD4+ T lymphocytes

AA Sequence

MSGESMNFSDVFDSSEDYFVSVNTSYYSVDSEMLLCSLQEVRQFSRLFVPIAYSLICVFGLLGNILVVIT      1 - 70
FAFYKKARSMTDVYLLNMAIADILFVLTLPFWAVSHATGAWVFSNATCKLLKGIYAINFNCGMLLLTCIS     71 - 140
MDRYIAIVQATKSFRLRSRTLPRSKIICLVVWGLSVIISSSTFVFNQKYNTQGSDVCEPKYQTVSEPIRW    141 - 210
KLLMLGLELLFGFFIPLMFMIFCYTFIVKTLVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAAN    211 - 280
LGKMNRSCQSEKLIGYTKTVTEVLAFLHCCLNPVLYAFIGQKFRNYFLKILKDLWCVRRKYKSSGFSCAG    281 - 350
RYSENISRQTSETADNDNASSFTM                                                  351 - 374
//

Text Mined References (150)

PMID Year Title
26536229 2015 Expression of CCL20 and Its Corresponding Receptor CCR6 Is Enhanced in Active Inflammatory Bowel Disease, and TLR3 Mediates CCL20 Expression in Colonic Epithelial Cells.
26345847 2015 Regulation of CD4?FOXP3? T cells by CCL20/CCR6 axis in early unexplained recurrent miscarriage patients.
26314374 Confirmation of CCR6 as a risk factor for anti-topoisomerase I antibodies in systemic sclerosis.
26156805 2015 The key role of astrocyte elevated gene-1 in CCR6-induced EMT in cervical cancer.
26138531 2015 Association of variants in CCR6 with susceptibility to lupus nephritis in Chinese.
26125463 2015 Chemokine Ligand 20: A Signal for Leukocyte Recruitment During Human Ovulation?
25928629 2015 RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population.
25879557 2015 Evaluation of blood redox-balance, nitric oxide content and CCR6 rs3093024 in the genetic susceptibility during psoriasis.
25833398 2015 PLZF regulates CCR6 and is critical for the acquisition and maintenance of the Th17 phenotype in human cells.
25768730 2015 Preferential recruitment of Th17 cells to cervical cancer via CCR6-CCL20 pathway.
25698534 2015 The involvement of cell surface nucleolin in the initiation of CCR6 signaling in human hepatocellular carcinoma.
25690781 2015 Potential role of CC chemokine receptor 6 in prediction of late-onset cytomegalovirus infection following solid organ transplant.
25661365 2015 The role of CCL20/CCR6 axis in recruiting Treg cells to tumor sites of NSCLC patients.
25585877 2015 The relationship between CCR6 and its binding partners: does the CCR6-CCL20 axis have to be extended?
25541254 2015 Human ?-defensin-3 increases the expression of interleukin-37 through CCR6 in human keratinocytes.
25408215 2015 Double negative (IgG+IgD-CD27-) B cells are increased in a cohort of moderate-severe Alzheimer's disease patients and show a pro-inflammatory trafficking receptor phenotype.
25201147 2015 Interleukin-17 induces CC chemokine receptor 6 expression and cell migration in colorectal cancer cells.
25178112 2014 Abnormal chemokine receptor profile on circulating T lymphocytes from nonallergic asthma patients.
25122636 2014 Deficient human ?-defensin 1 underlies male infertility associated with poor sperm motility and genital tract infection.
24984269 2014 CCL20/CCR6 promotes the invasion and migration of thyroid cancer cells via NF-kappa B signaling-induced MMP-3 production.
24980635 2014 CKR-L3, a deletion version CCR6-isoform shows coreceptor-activity for limited human and simian immunodeficiency viruses.
24979261 2014 CCR6 is a prognostic marker for overall survival in patients with colorectal cancer, and its overexpression enhances metastasis in vivo.
24958901 2014 Differentiation of IL-17-producing effector and regulatory human T cells from lineage-committed naive precursors.
24890729 2014 IL-1? promotes the differentiation of polyfunctional human CCR6+CXCR3+ Th1/17 cells that are specific for pathogenic and commensal microbes.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24866282 2014 CCR6, the sole receptor for the chemokine CCL20, promotes spontaneous intestinal tumorigenesis.
24782177 2014 Novel risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans.
24743888 2014 The effects of the CCR6/CCL20 biological axis on the invasion and metastasis of hepatocellular carcinoma.
24634224 2014 CC chemokine receptor 6 expression predicts poor prognosis in hepatocellular carcinoma.
24559209 2014 Chemokine receptor CCR6 expression is regulated by miR-518a-5p in colorectal cancer cells.
24401998 2014 Dermal clusters of mature dendritic cells and T cells are associated with the CCL20/CCR6 chemokine system in chronic psoriasis.
24394994 2014 CCR6 and CCL20: emerging players in the pathogenesis of rheumatoid arthritis.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24385540 2014 MicroRNA-150 inhibits tumor invasion and metastasis by targeting the chemokine receptor CCR6, in advanced cutaneous T-cell lymphoma.
24133439 2013 Genome-wide association study of autistic-like traits in a general population study of young adults.
23983073 2013 A regulatory variant in CCR6 is associated with susceptibility to antitopoisomerase-positive systemic sclerosis.
23959575 2014 Chemokine receptor CCR6-dependent accumulation of ?? T cells in injured liver restricts hepatic inflammation and fibrosis.
23935994 2013 FGFR1OP tagSNP but not CCR6 polymorphisms are associated with Vogt-Koyanagi-Harada syndrome in Chinese Han.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23835793 2013 High CCR6/CCR7 expression and Foxp3+ Treg cell number are positively related to the progression of laryngeal squamous cell carcinoma.
23790181 2013 CCR6/CCL20 chemokine expression profile in distinct colorectal malignancies.
23765988 2014 A role for the chemokine receptor CCR6 in mammalian sperm motility and chemotaxis.
23758411 2013 The expression of chemokine receptors CCR6, CXCR2 and CXCR4 is not organ-specific for distant metastasis in colorectal cancer: a comparative study.
23681234 2013 Recruitment of CCR6-expressing Th17 cells by CCL20 secreted from plasmin-stimulated macrophages.
23599932 2013 Enriched CD161high CCR6+ ?? T cells in the cerebrospinal fluid of patients with multiple sclerosis.
23306142 A case-control study suggests that the CCR6 locus is not involved in the susceptibility to giant cell arteritis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22926920 2012 Overexpression of CCL20 and its receptor CCR6 predicts poor clinical prognosis in human gliomas.
22859539 2012 A single-nucleotide polymorphism of CCR6 (rs3093024) is associated with susceptibility to rheumatoid arthritis but not ankylosing spondylitis, in a Taiwanese population.
22796894 2012 CXCR3-dependent recruitment and CCR6-mediated positioning of Th-17 cells in the inflamed liver.
22732549 2011 Regulation of atherogenesis by chemokine receptor CCR6.
22527137 2013 A CCR6 variant strongly associated with rheumatoid arthritis in two populations is not associated with ankylosing spondylitis.
22490506 2012 Increased frequency of CCR4+ and CCR6+ memory T-cells including CCR7+CD45RAmed very early memory cells in granulomatosis with polyangiitis (Wegener's).
22269120 2012 Investigation of JAK2, STAT3 and CCR6 polymorphisms and their gene-gene interactions in inflammatory bowel disease.
22092173 2012 Analysis of a genome-wide association study-linked locus (CCR6) in Asian rheumatoid arthritis.
22079021 2012 T lymphocyte recruitment into renal cell carcinoma tissue: a role for chemokine receptors CXCR3, CXCR6, CCR5, and CCR6.
21984702 2011 Epidermal CCR6+ ?? T cells are major producers of IL-22 and IL-17 in a murine model of psoriasiform dermatitis.
21949768 2011 Involvement of CCR6/CCL20/IL-17 axis in NSCLC disease progression.
21937703 2011 CCR6/CCR10-mediated plasmacytoid dendritic cell recruitment to inflamed epithelia after instruction in lymphoid tissues.
21935436 2011 Selective recruitment of regulatory T cell through CCR6-CCL20 in hepatocellular carcinoma fosters tumor progression and predicts poor prognosis.
21912453 2011 Effect of preoperative FOLFOX chemotherapy on CCL20/CCR6 expression in colorectal liver metastases.
21873313 2011 There is no association of CCR6 polymorphisms with susceptibility to Behcet's disease in two Chinese Han populations.
21763254 2011 Polymorphisms in CCR6 are associated with chronic graft-versus-host disease and invasive fungal disease in matched-related hematopoietic stem cell transplantation.
21724701 2011 CCL20 stimulates proinflammatory mediator synthesis in human fibroblast-like synoviocytes through a MAP kinase-dependent process with transcriptional and posttranscriptional control.
21624121 2011 Prognostic value of the expression of C-Chemokine Receptor 6 and 7 and their ligands in non-metastatic breast cancer.
21398606 2011 Memory CCR6+CD4+ T cells are preferential targets for productive HIV type 1 infection regardless of their expression of integrin ?7.
21376174 2011 CCR6 as a mediator of immunity in the lung and gut.
21300824 2011 CCL20/CCR6 feedback exaggerates epidermal growth factor receptor-dependent MUC5AC mucin production in human airway epithelial (NCI-H292) cells.
21261017 2010 [Expression of CCR6 and CCR7 in laryngeal squamous cell carcinoma].
21228329 2011 Epigenetic modification of the human CCR6 gene is associated with stable CCR6 expression in T cells.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21092675 2010 [Expression and clinical significance of CCR6, CCR7 and CD4(+)CD25(+) Foxp3(+) regulatory T cells in laryngeal squamous cell carcinoma and neck lymphatic metastasis].
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
20872189 2011 Expression of the chemokine receptor CCR6 correlates with a favorable prognosis in patients with adenocarcinoma of the lung.
20720211 2010 CCR6 marks regulatory T cells as a colon-tropic, IL-10-producing phenotype.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
20526340 2010 Common variants in FOXP1 are associated with generalized vitiligo.
20526339 2010 Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.
20511548 2010 Mesenchymal stem cells inhibit human Th17 cell differentiation and function and induce a T regulatory cell phenotype.
20483750 2010 Human beta-defensin 2 and 3 and their mouse orthologs induce chemotaxis through interaction with CCR2.
20459729 2010 CCL20/CCR6 expression profile in pancreatic cancer.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20453841 2010 A regulatory variant in CCR6 is associated with rheumatoid arthritis susceptibility.
20439195 2010 Expression of chemokine receptor CCR6 as a molecular determinant of adrenal metastatic relapse in patients with primary lung cancer.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20334681 2010 Dysregulated balance of Th17 and Th1 cells in systemic lupus erythematosus.
20220766 2010 Characterization of circulating dendritic cells in melanoma: role of CCR6 in plasmacytoid dendritic cell recruitment to the tumor.
20194631 2010 CCR6 is expressed on an IL-10-producing, autoreactive memory T cell population with context-dependent regulatory function.
20068036 2010 Specific binding and chemotactic activity of mBD4 and its functional orthologue hBD2 to CCR6-expressing cells.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20023216 2010 CCR6 ligands inhibit HIV by inducing APOBEC3G.
20022113 2010 Isoleucine/leucine2 is essential for chemoattractant activity of beta-defensin Defb14 through chemokine receptor 6.
19811428 2009 Activation of peripheral Th17 lymphocytes in patients with asthma.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19539215 2009 Recombinant human granulocyte colony-stimulating factor significantly decreases the expression of CXCR3 and CCR6 on T cells and preferentially induces T helper cells to a T helper 17 phenotype in peripheral blood harvests.
19492413 2009 CCL20/CCR6 chemokine/receptor expression in bone tissue from osteoarthritis and rheumatoid arthritis patients: different response of osteoblasts in the two groups.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19324905 2009 Induction of CCL20 production by Kaposi sarcoma-associated herpesvirus: role of viral FLICE inhibitory protein K13-induced NF-kappaB activation.
19305396 2009 C-C chemokine receptor 6-regulated entry of TH-17 cells into the CNS through the choroid plexus is required for the initiation of EAE.
19249008 2009 Diverse genome-wide association studies associate the IL12/IL23 pathway with Crohn Disease.
19233848 2009 CCR6 regulation of the actin cytoskeleton orchestrates human beta defensin-2- and CCL20-mediated restitution of colonic epithelial cells.
18703490 2008 CC-chemokine ligand 20/macrophage inflammatory protein-3? and CC-chemokine receptor 6 are overexpressed in myeloma microenvironment related to osteolytic bone lesions.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18465142 2008 Chemokine receptor CCR6 expression level and aggressiveness of prostate cancer.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18218038 2008 The effects of RANTES/CCR5 promoter polymorphisms on HIV disease progression in HIV-infected Koreans.
18097022 2008 Human T cells that are able to produce IL-17 express the chemokine receptor CCR6.
17615381 2007 Expression and role of CCR6/CCL20 chemokine axis in pulmonary sarcoidosis.
17562763 2007 Upregulation of CCL20 and recruitment of CCR6+ gastric infiltrating lymphocytes in Helicobacter pylori gastritis.
17171755 2007 Functional expression of chemokine receptor CCR6 on human effector memory CD8+ T cells.
17133360 2007 CCL20 chemokine induces both osteoblast proliferation and osteoclast differentiation: Increased levels of CCL20 are expressed in subchondral bone tissue of rheumatoid arthritis patients.
17075975 2006 Chemokine expression in hepatocellular carcinoma versus colorectal liver metastases.
16641550 2006 Involvement of chemokine receptor CCR6 in colorectal cancer metastasis.
16622267 2006 Chemokine receptor CCR6 expression level and liver metastases in colorectal cancer.
16621978 2006 The multiple personalities of the chemokine receptor CCR7 in dendritic cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16215992 2006 Cell differentiation dependent expressed CCR6 mediates ERK-1/2, SAPK/JNK, and Akt signaling resulting in proliferation and migration of colorectal cancer cells.
16095490 2005 MIP-3alpha/CCL20 in renal transplantation and its possible involvement as dendritic cell chemoattractant in allograft rejection.
15701269 Co-localization of macrophage inflammatory protein-3alpha (Mip-3alpha) and its receptor, CCR6, promotes pancreatic cancer cell invasion.
15591779 Molecular characterization of CCR6: involvement of multiple domains in ligand binding and receptor signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15483227 2005 Chemokine receptor CCR6 transduces signals that activate p130Cas and alter cAMP-stimulated ion transport in human intestinal epithelial cells.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12642342 2003 Coincident expression of the chemokine receptors CCR6 and CCR7 by pathologic Langerhans cells in Langerhans cell histiocytosis.
12514792 2002 CCR6 is a functional chemokine receptor that serves to identify select B-cell non-Hodgkin's lymphomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12193700 2002 CCR6 colocalizes with CD18 and enhances adhesion to activated endothelial cells in CCR6-transduced Jurkat T cells.
12149255 2002 The structure of human macrophage inflammatory protein-3alpha /CCL20. Linking antimicrobial and CC chemokine receptor-6-binding activities with human beta-defensins.
12081481 2002 Mutating the four extracellular cysteines in the chemokine receptor CCR6 reveals their differing roles in receptor trafficking, ligand binding, and signaling.
12070001 2002 Trafficking machinery of NKT cells: shared and differential chemokine receptor expression among V alpha 24(+)V beta 11(+) NKT cell subsets with distinct cytokine-producing capacity.
12067311 2002 Macrophage inflammatory protein 3alpha-CC chemokine receptor 6 interactions play an important role in CD4+ T-cell accumulation in periodontal diseased tissue.
11994436 2002 Human B cells become highly responsive to macrophage-inflammatory protein-3 alpha/CC chemokine ligand-20 after cellular activation without changes in CCR6 expression or ligand binding.
11751947 2002 Up-regulation of CCR5 and CCR6 on distinct subpopulations of antigen-activated CD4+ T lymphocytes.
11714836 2001 Mediators of innate immunity that target immature, but not mature, dendritic cells induce antitumor immunity when genetically fused with nonimmunogenic tumor antigens.
11164896 2001 Chemokine receptor expression by human syncytiotrophoblast.
11001880 2000 Regulation of CCR6 chemokine receptor expression and responsiveness to macrophage inflammatory protein-3alpha/CCL20 in human B cells.
10521347 1999 Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6.
9294138 1997 CCR6, a CC chemokine receptor that interacts with macrophage inflammatory protein 3alpha and is highly expressed in human dendritic cells.
9294137 1997 Cloning and characterization of a specific receptor for the novel CC chemokine MIP-3alpha from lung dendritic cells.
9223454 1997 STRL22 is a receptor for the CC chemokine MIP-3alpha.
9186513 1997 A somatic cell hybrid panel for distal 17q: GDIA1 maps to 17q25.3.
9169459 1997 Identification of CCR6, the specific receptor for a novel lymphocyte-directed CC chemokine LARC.
9070937 1997 Cloning of STRL22, a new human gene encoding a G-protein-coupled receptor related to chemokine receptors and located on chromosome 6q27.
8886020 1996 Molecular cloning and RNA expression of two new human chemokine receptor-like genes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.