Property Summary

NCBI Gene PubMed Count 955
PubMed Score 4115.53
PubTator Score 2862.53

Knowledge Summary

Patent (377,871)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 192 7.32 3.7
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 106 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1683 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
tuberculosis -1.800 1.4e-04
adult high grade glioma 1.900 7.8e-06
Astrocytoma, Pilocytic 1.200 8.6e-05
cutaneous lupus erythematosus 1.700 4.4e-03
ductal carcinoma in situ 1.300 1.7e-02
glioblastoma 1.200 1.7e-05
head and neck cancer and chronic obstruc... 1.100 1.1e-02
hepatocellular carcinoma 1.400 1.4e-03
interstitial cystitis 1.500 1.1e-03
invasive ductal carcinoma 1.300 1.8e-02
lung cancer -1.100 2.6e-02
osteosarcoma 1.011 4.4e-02
primary Sjogren syndrome 1.300 8.0e-04
psoriasis 1.200 1.0e-39
sarcoidosis 1.500 3.1e-02
subependymal giant cell astrocytoma 1.192 3.6e-02

Protein-protein Interaction (1)

Gene RIF (1543)

AA Sequence

MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLL      1 - 70
NLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKAR     71 - 140
TVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVM    141 - 210
VICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQ    211 - 280
VTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISV    281 - 350
GL                                                                        351 - 352
//

Text Mined References (958)

PMID Year Title