Property Summary

NCBI Gene PubMed Count 928
PubMed Score 4040.12
PubTator Score 2862.53

Knowledge Summary

Patent (377,871)

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
psoriasis 6685 1.01368344206925E-39
adult high grade glioma 2148 7.83949282755509E-6
tuberculosis and treatment for 6 months 686 1.52868087544555E-5
pilocytic astrocytoma 3086 5.58259737786372E-5
lung cancer 4473 1.59857720313737E-4
glioblastoma 5572 3.16018995144003E-4
primary Sjogren syndrome 789 7.99353575763771E-4
interstitial cystitis 2299 0.00114661140470308
hepatocellular carcinoma 550 0.0013994849601055
cutaneous lupus erythematosus 1056 0.00437868510484391
head and neck cancer and chronic obstructive pulmonary disease 237 0.0111166606095583
ductal carcinoma in situ 1745 0.0170313034502198
invasive ductal carcinoma 2950 0.0182674816448208
sarcoidosis 368 0.0314599781982293
subependymal giant cell astrocytoma 2287 0.0359118837346054
osteosarcoma 7933 0.0443551168933903
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 104 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 0.0 4.0

Expression

Synonym

Accession P51681 O14692 O14693 O14695 O14696 O14697 O14698 O14699 O14700 O14701 O14702 O14703 O14704 O14705 O14706 O14707 O14708 O15538 Q9UPA4 C-C CKR-5
Symbols CKR5
CCR-5
CD195
CKR-5
CCCKR5
CMKBR5
IDDM22
CC-CKR-5

Gene

PDB

1ND8   1NE0   1OPN   1OPT   1OPW   2L87   2MZX   2RLL   2RRS   4MBS  

  Ortholog (5)

Species Source
Chimp OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

  TechDev Info (1)

Gene RIF (1510)

PMID Text
27139347 no anti-HIV positive individuals were found among surgical staff, one in one hundred were resistant to HIV infection.
27026376 The authors provide the first evidence that shows CCR5 interaction with a dual-tropic HIV-1 Env played a significant role in Env-induced depletion of CD4 T cells.
26982176 individuals carrying heterozygous or homozygous genotypes (GA+AA) for CCR2-64I polymorphisms seem to be at lower risk for cervical lesion [odds ratio (OR) = 0.37, p = 0.0008)]. The same was observed for the A allele (OR = 0.39, p = 0.0002), while no association was detected (p > 0.05) with CCR5-Delta32 polymorphism.
26906062 The results of this study infer CCR5 and CCL5 participate in the response to tick-borne encephalitis virus, as well as to other neurotropic pathogens.
26674113 Data suggest that gene therapy that only targets the CC Chemokine Receptor 5 (CCR5) co-receptor fails to suppress HIV-1.
26629902 concluded that CCR5-peptidoliposomes increase the efficiency of sCD4 to inhibit HIV infection by acting as bait for sCD4-primed virus, catalyzing the premature discharge of its fusion potential
26599761 the CCR5Delta32 polymorphism does not seem to influence the different clinical manifestations of Chagas disease but there is involvement of the CCR5 59029 A/G polymorphism in susceptibility to the different forms of chronic Chagas disease.
26585937 Data indicate that on addition of the heat-shock proteins GroEL-GroES molecular chaperone system, the folding of the nascent chemokine receptor type 5 (CCR5) was significantly enhanced.
26512140 The relationship between CCR5 variation, HIV-1 reservoir size, lymphocyte activation, and CCR% expression in patients receiving ant-HIV therapy is reported.
26472202 The residues on the N-loop and beta-sheets of MIP-1a are close to both CCR1 and CCR5, and those in the C-terminal helix region are close to CCR5.
More...

AA Sequence

MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLL      1 - 70
NLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKAR     71 - 140
TVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVM    141 - 210
VICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQ    211 - 280
VTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISV    281 - 350
GL                                                                        351 - 352
//

Text Mined References (931)

PMID Year Title
27139347 2015 Concerns of occupational HIV infection among surgical Staff in the light of anti-HIV sero-status and the distribution of ?32 allele of the CCR5 gene: a cross-sectional study.
27026376 2016 CCR5 interaction with HIV-1 Env contributes to Env-induced depletion of CD4 T cells in vitro and in vivo.
26982176 2016 CCR2 and CCR5 genes polymorphisms in women with cervical lesions from Pernambuco, Northeast Region of Brazil: a case-control study.
26906062 2016 The expression of the chemokine receptor CCR5 in tick-borne encephalitis.
26674113 2015 HIV-1 CCR5 gene therapy will fail unless it is combined with a suicide gene.
26629902 2015 Functional Mimetics of the HIV-1 CCR5 Co-Receptor Displayed on the Surface of Magnetic Liposomes.
26599761 2015 Genetic Susceptibility to Cardiac and Digestive Clinical Forms of Chronic Chagas Disease: Involvement of the CCR5 59029 A/G Polymorphism.
26585937 2015 Folding of newly translated membrane protein CCR5 is assisted by the chaperonin GroEL-GroES.
26512140 2016 CCR5-?32 Heterozygosity, HIV-1 Reservoir Size, and Lymphocyte Activation in Individuals Receiving Long-term Suppressive Antiretroviral Therapy.
26472202 2015 Elucidation of the CCR1- and CCR5-binding modes of MIP-1? by application of an NMR spectra reconstruction method to the transferred cross-saturation experiments.
More...