Property Summary

Ligand Count 607
NCBI Gene PubMed Count 157
PubMed Score 397.93
PubTator Score 340.47

Knowledge Summary

Patent (70,161)

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 1.7e-07

Protein-protein Interaction (2)

Gene RIF (138)

AA Sequence

MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILIKYRRLRIMTN      1 - 70
IYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSEIFFIILLTIDRYLAIVHAVF     71 - 140
ALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEETLCSALYPEDTVYSWRHFHTLRMTIFCLVL    141 - 210
PLLVMAICYTGIIKTLLRCPSKKKYKAIRLIFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLD    211 - 280
LVMLVTEVIAYSHCCMNPVIYAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPE    281 - 350
LSIVF                                                                     351 - 355
//

Text Mined References (158)

PMID Year Title