Property Summary

NCBI Gene PubMed Count 420
PubMed Score 1034.31
PubTator Score 668.36

Knowledge Summary

Patent (131,367)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Celiac disease 112 0.0 2.0

Expression

  Differential Expression (23)

Disease log2 FC p
gastric cancer 1.600 1.4e-03
hepatocellular carcinoma 2.600 4.2e-06
pancreatic cancer 2.900 2.7e-04
Waldenstrons macroglobulinemia 1.300 4.5e-02
cutaneous lupus erythematosus 1.700 1.1e-02
osteosarcoma -3.575 4.4e-05
glioblastoma 1.200 5.0e-03
chronic kidney disease 1.400 3.6e-02
tuberculosis 2.800 5.1e-04
intraductal papillary-mucinous carcinoma... -2.100 2.8e-03
intraductal papillary-mucinous neoplasm ... -2.100 2.3e-02
lung cancer -2.100 6.7e-05
sarcoidosis 1.500 1.9e-02
interstitial cystitis 2.000 2.8e-03
adult high grade glioma 1.200 1.7e-04
primary Sjogren syndrome 1.800 2.8e-05
pancreatic carcinoma 2.900 2.7e-04
psoriasis 1.100 1.9e-06
lung carcinoma -1.300 2.7e-15
ulcerative colitis 1.800 3.6e-05
ovarian cancer -1.800 2.0e-07
head and neck cancer -1.500 2.2e-02
head and neck cancer and chronic obstruc... 1.300 6.7e-03

 OMIM Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (438)

PMID Text
27534043 CCR2 gene polymorphism (64I allele carriage) is a predisposing factor for allergy.
27239844 The frequencies of the rare alleles of CCR2, ITGB3, and 3'UTR of c-fms in the Old Believers are lower than in the sample of Novosibirsk Russians, and the rare allele of DBH is more frequent
26982176 data suggest that the CCR2-64I polymorphism is associated with the protective effect to development of cervical lesions as well as in the protection to HPV 16 infection.
26648448 These findings suggested that the CCL2/CCR2 chemokine signaling may regulate the epithelial-mesenchymal transition.
26300579 Among HIV-seropositive samples 3.4% were homozygous CCR2-64I mutants, 17.8%) were heterozygous,78.8% were CCR2 wild type.
26211665 Ovarian cancer cells express both Hp and its receptor CCR2 but only after exposure to ascitic fluid, inducing moderated cell migration; results suggest that Hp-induced changes in the cell morphology, actin cytoskeleton structure, and migration ability of tumor cells, is possibly "preparing" these cells for the potential induction of the metastatic phenotype.
26123579 Association of hydrogen sulfide with alterations of monocyte chemokine receptors, CCR2 and CX3CR1 in patients with coronary artery disease
25966143 A polymorphism in MCP-1 may be correlated with the development of non-small cell clung cancer (NSCLC) in the Han nationality of Northern China. However, the polymorphism in CCR-2 is not involved in NSCLC.
25808810 results suggest that senescent dermal fibroblasts recruit stem cells by secreting various factors and that the CCL2/CCR2 axis is one of the mechanisms underlying this phenomenon
25797207 Single nucleotide polymorphism is associated with Non-Small Cell Lung Cancer in Tunisian patients
25779331 CCR2 is directly involved in the detrimental infiltration of neutrophils into the joints in patients with rheumatoid arthritis (RA), showing a new inflammatory role of CCR2 during RA flares or active disease.
25760842 There is no association between CCR2 gene rs1799864 polymorphism and the risk for hemophagocytic lymphohistiocytosis(HLH) in children.
25614627 Data indicate that coupling selectivity of chemokine receptors CCR2, CCR5, and CCR7 with G protein subtypes was measured and compared.
25604634 Data suggest that CCR2 +190 G/A polymorphism may increase the susceptibility to MS, but its action seems to be restricted to individuals who do not possess the major risk allele HLA-DRB1*15:01.
25503251 The study found a significant positive correlation between CCR2 and CX3CR1 expression on CD8+ cells (r = 0.727, p = 0.0001)in patients with age-related macular degeneration.
25411969 Study shows the increase of CCR2 gene expression in monocytes of severe obstructive sleep apnea patients and that monocytic CCR2 gene expression can be induced under intermittent hypoxia which contributes to the chemotaxis and adhesion of monocytes.
25370917 The CCR-2 gene polymorphisms may not be genetic risk factors for Parkinson disease in the Han Chinese population, and they do not appear to influence cognitive function and depression in PD patients.
25313609 These findings suggest that CCR2, CX3CR1, RANTES and SDF1 gene variants seem to play an important role in the dynamics of HIV infection and could be used as drug or vaccine targets.
25312961 Results show that nerve-released CCL2 supports prostate cancer migration and perineural invasion though CCR2-mediated signaling.
25312802 The results confirm that variants of CCR5 and CCR2 genes and their haplotypes are associated with the severity but not with susceptibility to develop chagasic cardiomyopathy.
25283965 results support a model of CCR2 equilibrium: chemokine binding changes the conformational equilibrium of CCR2 toward the active state, and Pro-C switches its binding partner from the membrane to FROUNT
25266801 A significantly enhanced risk for prostate cancer due to interactions between CCL2 and CCR2 gene variants.
25261725 HCMV infection is able to activate the CCL2-CCR2 interactions to further enhance HCMV infection and/or replication
25250834 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
25149422 The CCR2 mRNA were significantly increased in demyelinated Multiple Sclerosis hippocampus.
25139016 These results show that intermediate monocytes are increased in frequency soon after infection; express CCR2, which would promote their migration into the lesions; and, owing to their production of TNF, can enhance the inflammatory response.
24984897 This brief review summarizes our current understanding of the physiologic and pathologic roles of CCR2, focusing on its involvement in CNS inflammatory diseases.
24970887 Unique properties of human beta-defensin 6 (hBD6) and glycosaminoglycan complex: sandwich-like dimerization and competition with the chemokine receptor 2 (CCR2) binding site.
24778447 cross-desensitization of CCR1 by FPR1 was associated with CCR1 phosphorylation and moderate reduction of CCR1 cell-surface expression. In contrast, CCR2 was not phosphorylated or internalized after FPR1 activation.
24639350 CCL2-CCR2 axis regulates macrophage polarization by influencing the expression of functionally relevant and polarization-associated genes and downmodulating proinflammatory cytokine production.
24489825 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
24453913 No association was found between the CCR2V64Il polymorphism and susceptibility to migraine or headache severity in the Iranian population.
24406043 Findings suggests that CCR2 expression is crucial for CCL2-induced proliferation and invasion of PC-3M cells.
24344240 IL-33 enhances proliferation and invasiveness of decidual stromal cells by up-regulation of CCL2/CCR2 via NF-kappaB and ERK1/2 signaling.
24332572 indicate that three genes, namely Chemokine (C-X-C motif) receptor 2 (CXCR2), C-C chemokine receptor type 2 (CCR2) and E1A-Binding Protein P400 (EP400), were able to identify HCC individually with accuracies of 82.4%, 78.4% and 65%, respectively.
24327013 Our data demonstrate that the monocyte-specific chemokine CCL7 and its receptor CCR2 are expressed in tumour cells of RCC
24185682 CCL2 produced by senescent biliary epithelial cells may promote infiltration of corresponding CCR2-expressing cells and further aggravate inflammation in bile duct lesion in primary biliary cirrhosis.
24128342 A functional binding element in helix 8 of CCR2 is described for the cytosolic regulator FROUNT.
24098976 CCR5-Delta32 allele is not responsible for HIV-1 resistance in this HESN group; however, the CCR2-I allele could be protective, while the 29G allele might increase the likelihood of acquiring HIV-1 infection
24083412 genetic polymorphism is not associated with ischemic stroke in Armenian population
24078580 CCL2 rs1024611 and CCR2 rs1799864 polymorphisms is not associated with myocardial infarction.
24011637 These data demonstrate a linkage disequilibrium between CCR2 and CCR5 at several loci.
23922698 The entry of HIV infected and uninfected CD14(+)CD16(+) monocytes into the brain was facilitated by significantly increased surface JAM-A, ALCAM, CD99, and PECAM-1, as compared to CD14(+) cells that are CD16 negative.
23880174 CCR2-64I (A/A genotype) may account for the protection against HIV-1 infection in population from west region of Cameroon.
23876399 This meta-analysis suggests that genetic polymorphisms of CCR2 V64I may influence the susceptibility of cancer in Asian countries.[meta-analysis]
23846739 Data suggest that CCL13 binds to several chemokine receptors (CCR1, CCR2, and CCR3), allowing CCL13 to elicit different effects on target cells of immune system. CCL13/CCR2 signal transduction induces dendritic cell maturation/activation. [REVIEW]
23771498 Data suggest signaling via CCL2 (chemokine [C-C motif] ligand 2) and CCR2 (CCL2 receptor) is involved in pathogenesis of neurodegenerative/neuroinflammatory disorders such as Alzheimer disease, multiple sclerosis, and ischemic brain injury. [REVIEW]
23727176 We noticed higher prevalence of CCR2 A allele as well as lower frequency of CCR5 d32 in chronic urticaria group in comparison to control group
23686489 This work identifies a novel protective role for CCL2/CCR2 in the tumor microenvironment
23657965 MCP-1 -2518A/G and CCR2 190G/A polymorphisms are risk factors for renal cell carcinoma.
23632061 Our data suggest the influence of CCR2-64I variant in the development of prostate cancer.
23612252 CCR2-V64I may contribute to an increased risk of bladder, cervical and oral cancer.[meta-analysis]
23454776 No significant association has been found between MCP-1, CCR2 and CCR5 polymorphisms and atopic asthma in Tunisian patients.
23427179 In a population of women from Taiwan, an SNP in CCR-2 was not found to be associated with cervical cancer.
23408426 interaction with the sulfated N terminus of CCR2 destabilizes the dimerization interface of inactive dimeric MCP-1, thus inducing dissociation to the active monomeric state
23376609 CCR2 is absent from human adipose lineage cells.
23374597 The proportion of CCR2+ monocytes and CCR2 MFI were correlated with body weight, body mass index, fat mass, insulin and HOMA-IR. Oxidative burst also correlated with anthropometric measures, fat mass and expression of CCR2.
23325742 Two hundred and twenty-one samples from HIV-infected subjects in Thailand were genotyped for the CCR5, CCR2, and SDF1 mutation. Results demonstrated that there was a significant association between CD4+ T-cell numbers and CCR2 and SDF1 polymorphisms.
23298254 Data indicate that women with systemic lupus erythematosus (SLE) responded similar to pregnancy as did healthy women with lower percentages of CCR2+, CCR5+ and CXCR3+ monocytes.
23185512 Our results suggest that CCL2 increases VCAM-1 expression in human OASFs via the CCR2, PKCdelta, p38MAPK, c-Jun, and AP-1 signaling pathway. The CCL2-induced VCAM-1 expression promoted monocytes adhesion to human OASFs.
23185481 We analyzed the association between single neucleotide polymorphisms (SNPs) of CCL2 (rs4586) and CCR2 (rs1799865) with their respective protein levels.Our results revealed that individuals possessing both SNPs are at a higher risk of development of AMD
23090289 There was no significant relationship between CCR2 expression in tumor cells and clinical and pathological characteristics. Also, no significant positive correlation between MCP-1 and CCR2 expression was revealed
23057571 there were strong gene-gene interactions between the CCR5 promoter and CCR2 polymorphisms on the susceptibility of HIV-1 infection
23041556 chemokine receptors may be added to the spectrum of the immunogenetic factors that are known to be associated with renal allograft rejection.
23007133 Findings suggest that the MCP-1/CCR2 system is directly involved in PD-related EMT and ECM synthesis and that this is mediated, at least in part, via TGF-beta1.
22927430 CCL2/CCR2 chemokine signaling coordinates survival and motility of breast cancer cells through Smad3 protein- and p42/44 mitogen-activated protein kinase (MAPK)-dependent mechanisms.
22909007 Structure prediction and molecular dynamics simulations of a G-protein coupled receptor: human CCR2 receptor
22842622 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
22815949 thymic Sirpalpha(+) cDCs crucially contribute to a process of intrathymic tumor immune tolerance that involves CCR2 and CCL2
22752804 MCP-1-2518G and CCR-2 64I gene polymorphisms represent important factors in determining susceptibility to CAD, and the contribution of MCP-1-2518G could be through effects on atrial fibrillation in CAD patients.
22685564 Data suggest that downregulation of peripheral blood mononuclear cells (PBMCs) chemokine receptor-2 (CCR2) may indicate its etio-pathological relevance in amyotrophic lateral sclerosis (ALS) pathogenesis.
22615942 During chemotaxis CCR2 expressed on monocytes internalizes with the bound chemoattractant, but cycles rapidly back to the plasma membrane to maintain high responsiveness
22612293 data indicate that gene polymorphism of CCR2 V64I may influence the susceptibility and clinicopathological characteristics of prostate cancer and CCR5 Delta32 allele may also be an important risk factor for prostate cancer in Turkish men population
22607625 that CCR2 expression is associated with lower MMSE scores in an older human population
22554651 Genetic variants of CCL2,CCL5,CCR2 & CCR5, (reported to be associated with susceptibility to pulmonary tuberculosis in certain ethnic populations), were studied in Sahariya tribe, a primitive tribe of N.Central India having a high prevalence of TB.
22479344 Data show that the acidic residues Glu291 in CCR2 and Glu283 in CCR5 are important binding sites.
22285384 The CCR2-Val64Ile polymorphism was not associated with myocardial infarction in Tunisian male subjects.
22276574 MCP-1 -2518 A/G and CCR2 190G/A polymorphisms are new risk factors for COPD
22226505 CCL2 binding to primary adult human astrocytes is CCR2-independent and is likely to be mediated via the D6 decoy chemokine receptor.
22218121 Results failed to suggest CCR2-V64I or CCR5-Delta32 gene polymorphisms as risk factors for acute rejection and delayed graft function in kidney transplantation.
22197827 MCP-1/CCR-2-deficient pathway is crucial for recruitment of hematogenous macrophages to the inflamed brain following ischemia.
22183310 CCL2-CCR2 and CXCL1-CXCR1 signaling are involved in age related macular degeneration.
22159219 Glioma lines did not express the CCL2 receptor, CCR2, which was found on microglia.
22086059 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
22081934 Our findings have suggested that MCP-1 and CCR2 gene variants were risk factors for osteoporosis and osteopenia.
22041342 The frequency of CCR2-Val64Ile polymorphism is significantly high in chronic renal failure patients requiring long-term hemodialysis.
22026334 Our data suggests that the CCR5(-59029) A, CCR2 (64Ile) and MCP-1(-2518) G allele profiles predispose to persistent hepatitis C virus infection.
21890375 The effect of adiponectin on CCL2, -3, -4, and -5 and their corresponding receptors CCR1, CCR2, and CCR5 has been analyzed.
21883707 64I allele of CCR2 may be risk factor for oral squamous cell carcinoma
21868018 The CCR2 V64I allele has not been found any association with coronary artery disease.
21682549 Data suggest that C-reactive protein (CRP) stimulation may induce CC chemokine receptor 2 (CCR2) overexpression on monocytes and then promote the chemotaxis ability of monocytes.
21667221 Genetic polymorphisms of CCR2 with high allele frequencies are associated with less HIV-1 pathogenesis.
21602126 CCR5delta32, CCR2-64I and SDFl-3 A gene polymorphisms do not show strong correlations to HIV-1 infection in the Chinese population.
21570337 genetic polymorphism of CCR2-64I may contribute to the susceptibility to oral cancer.
21527853 TNF-alpha blockage by infliximab reduces CCL2 and CCR2 levels in patients with rheumatoid arthritis
21461583 The meta-analysis clarified that the CCR2-Val64Ile polymorphism has no effect on susceptibility to HIV-1 infection in the total population.
21450101 CCL2 secreted by tumor cells and CCR2 receptors on cytotoxic T lymphocytes (CTLs) are involved in migration of CTLs towards tumor.
21440726 CCR2-64I polymorphism may have a role in predisposition to acute kidney allograft loss in Tunisia
21429204 Among Zambian discordant couples, HIV-1 CCR2-CCR5 coreceptor gene haplotypes appear to modulate HIV-1 viral load in seroconverters and alter the rate of HIV-1 acquisition by HESNs (HIV-1 exposed seronegatives).
21396623 Besides overall immune health, host genetic factors influence mortality, retinitis progression, and retinal detachment in patients with AIDS and CMV retinitis that are receiving HAART.
21348591 CC chemokine receptor 2 and IL-8 play roles in the pathogenesis and resolution of acute lung injury (ALI) and acute respiratory distress syndrome (ARDS).
21322034 Cytl1 could be a structurally and functionally related analog of CCL2 signaling through the chemokine receptor CCR2.
21264360 the combined association of CCR2-V64I and MCP-1-2518A/G polymorphisms may play an important role in determining generalized aggressive periodontitis susceptibility in Chinese females
21220372 The present study, showed us a relationship between CCR2-V64I polymorphism and abdominal aortic aneurysms.
21148810 TLR2 negatively regulates CCR1, CCR2, and CCR5 on blood monocytes by activating chemokine-dependent down-modulation and providing a molecular mechanism for inhibiting monocyte migration after pathogen recognition.
21146687 treatment with telmisartan results in a significant attenuation of MCP-1 gene expression
21097672 Osteoclast-gene expression profiling reveals osteoclast-derived CCR2 chemokines promoting myeloma cell migration.
21097527 MCP-1 has a novel function in airway epithelium, increasing the two major airway mucins MUC5AC and MUC5B, an effect mediated, at least in part, by a cascade of events initiated by interaction of its receptor CCR2B with G(q) subunits in caveolae
21091093 Gastric cancer risk was not associated with single chemokine polymorphisms, but associations were found between cancer risk and a CCR5 haplotype and between survival and polymorphisms in CCR2 and CCR5.
21054877 Observational study of gene-disease association. (HuGE Navigator)
20947712 Variants in the CCL2 and CCR2 genes show strong associations with several pretraining muscle strength traits, indicating that inflammatory genes in skeletal muscle contribute to the polygenic system that determines muscle phenotypes.
20947712 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20842059 recombinant expression on tumor antigen-specific T cells enhances tumor trafficking
20808917 FLNa as an important protein for controlling the internalization and spatial localization of the CCR2B receptor
20740585 CCR2-64I gene polymorphism is an important factor for the susceptibility of hepatocellular carcinoma (HCC) but it might not influence the clinical pathological progression of HCC.
20726788 along with MCP-1, haplotype variants are associated with preeclampsia in Turkey
20726788 Observational study of gene-disease association. (HuGE Navigator)
20681057 This review focuses on current knowledge of CCL2 and its cognate receptor CCR2, both expressed in physiological conditions and during human neurodegenerative diseases.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20637631 Neither the MCP-1 -2518G (p=0.43) nor the CCR2 64Ile (p=0.52) variant contributed to the risk of multiple sclerosis in Tunisians.
20637631 Observational study of gene-disease association. (HuGE Navigator)
20628649 Observational study of gene-disease association. (HuGE Navigator)
20605053 crucial for the recruitment of blood monocytes into tumor fibroblastic areas
20603037 Observational study of gene-disease association. (HuGE Navigator)
20537184 CCR2 is important in invasive cancer of the cervix but not in HPV infection or in the development of pre-cancers.
20537184 Observational study of gene-disease association. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20531015 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20483750 human beta-defensin (hBD)2 and 3 are chemotactic for a broad spectrum of leukocytes in a CCR6- and CCR2-dependent manner
20452482 Observational study of gene-disease association. (HuGE Navigator)
20449800 CCR2-64I is a new risk factor for bladder cancer.
20449800 Observational study of gene-disease association. (HuGE Navigator)
20442634 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20411675 Observational study of gene-disease association. (HuGE Navigator)
20380698 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
20364004 there appears to be an association between polymorphism of CCL2 and its receptor CCR2 and endometrial cancer
20364004 Observational study of gene-disease association. (HuGE Navigator)
20339010 In summary, we found that SNPs in CCL2 and CCR2 are associated with exercise-induced muscle damage and that the presence of certain variants may result in an exaggerated damage response to strenuous exercise.
20339010 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20231199 Observational study of gene-disease association. (HuGE Navigator)
20220260 Observational study of gene-disease association. (HuGE Navigator)
20182805 The effect of genetic variants of CCR2-V64I and CCR5-delta32 chemokine receptors on the development of myocardial infarction, was investigated.
20182805 Observational study of gene-disease association. (HuGE Navigator)
20181074 Observational study of gene-disease association. (HuGE Navigator)
20153665 The genetic variation at the CCR2/CCR5 genes did not contribute to the risk for psoriasis, but CCR2 polymorphisms could modulate the risk for arthritis in patients with psoriasis.
20153665 Observational study of gene-disease association. (HuGE Navigator)
20066125 Observational study of gene-disease association. (HuGE Navigator)
20038229 Meta-analysis of gene-disease association. (HuGE Navigator)
20017911 Our data show that Haptoglobin is a novel monocyte chemoattractant and that its chemotactic potential is mediated, at least in part. by its interaction with CCR2.
19965779 Selective CCR2 antagonist decreased macrophage infiltration in ApoE deficient atherosclerotic mice.
19958843 Observational study of gene-disease association. (HuGE Navigator)
19950235 Observational study of gene-disease association. (HuGE Navigator)
19942750 Data show that genotype frequencies of CCR2, MCP-1 and DC-SIGN polymorphisms did not differ significantly between the study groups, but a significantly increased frequency of SDF-1alpha polymorphism was observed among HIV+PTB+ patients.
19942750 Observational study of gene-disease association. (HuGE Navigator)
19917610 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
19904283 The chemokine system CC ligand 2 (CCL2) with its receptor CC receptor 2 (CCR2) have been implicated in a wide range of neuropathologies, including trauma, ischemic injury and multiple sclerosis--REVIEW
19841162 FROUNT binds to the C-terminal domain of CCR5 in addition to that of CCR2.
19720836 CCL2-expressing breast tumor cells engage CCR2(+) stromal cells of monocytic origin, including macrophages and preosteoclasts, to facilitate colonization in lung and bone
19693089 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19669591 A potentially important role of CCR2-64I allele in AIDS progression in the northern Chinese population, was identified.
19669591 Observational study of gene-disease association. (HuGE Navigator)
19643177 Knockdown of clathrin by RNA interference impairs CCR2 internalization, as does treatment with the dynamin inhibitor, dynasore.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19559392 Observational study of gene-disease association. (HuGE Navigator)
19535619 A recombinant form of the CCL2 receptor selectively binds CCL2 and neutralizes its biological activity, including chemotaxis of human monocytes; it inhibits proliferation and migration of prostate cancer cells expressing CCL2 and its receptor.
19527467 C-C chemokine receptor 2 expression by circulating monocytes influences atherosclerosis in patients on chronic hemodialysis
19526283 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
19520154 rs3918356 and rs743660 polymorphisms in CCR2 were found to be associated with increased serum IgE levels in asthma.
19520154 Observational study of gene-disease association. (HuGE Navigator)
19506371 Single nucleotide polymorphisms in monocyte chemoattractant protein-1 and its receptor act synergistically to increase the risk of carotid atherosclerosis.
19506371 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19465829 The effects of multiple CCR2 mutations on HIV viral load and vertical disease transmission is reported among pregnant women in Nairobi, Kenya.
19433914 Sequence variants of chemokine receptor CCR2 genes and susceptibility to HIV-1 infection
19433914 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19411748 The serum MCP-1 concentrations and protein expression of CCR2 in acute coronary syndrome patients are significantly higher than those in healthy controls.
19263529 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19225544 Observational study of gene-disease association. (HuGE Navigator)
19196047 No risk for End-stage renal disease was seen for CCR2 and CCR5 haplotypes.
19196047 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19124913 Observational study of gene-disease association. (HuGE Navigator)
19098363 The chemokine receptors CCR2-V64I (A) and CCR5- 59029 A alleles may influence renal allograft survival.
19098363 Observational study of gene-disease association. (HuGE Navigator)
19082218 The CCR2V641 G - A polymorphism was transmitted preferentially from parents to asymptomatic non-asthmatic children, suggesting an important role for the CCR2 receptor in modulating airway inflammation independent of atopy.
19082218 Observational study of gene-disease association. (HuGE Navigator)
19064579 Observational study of gene-disease association. (HuGE Navigator)
19055601 The results suggest that MCP-1, but not CCR2 gene variants, may participate in the pathogenesis of allergic phenotypes at least in the Caucasian population.
19055601 Observational study of gene-disease association. (HuGE Navigator)
19037908 CCR2-64I allele to be associated with reduced risk for allograft rejection in North Indian transplant recipients influencing allograft outcome.
19032065 Observational study of genotype prevalence. (HuGE Navigator)
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19017998 infiltrated neutrophils from patients with chronic inflammatory lung diseases and rheumatoid arthritis highly express CCR1, CCR2, CCR3, CCR5, CXCR3, and CXCR4
19002595 activation of MCP-1/CCR2 axis promotes PCa growth in bone.
18996288 Observational study of gene-disease association. (HuGE Navigator)
18977759 Role of CC chemokine receptor 2 in bone marrow cells in the recruitment of macrophages into obese adipose tissue.
18974840 Observational study of gene-disease association. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18928397 Observational study of gene-disease association. (HuGE Navigator)
18855658 Observational study of gene-disease association. (HuGE Navigator)
18846510 The direct interaction of CCR2 with transportin1 (TRN1) is followed by CCR2 receptor internalization. TRN1-binding to CCR2 promotes its nuclear translocation in a TRN1-dependent manner.
18845960 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18829011 Protein expression of CCR2 are identified in the four ovulatory phases.
18763111 Observational study of genotype prevalence. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18615095 Observational study of gene-disease association. (HuGE Navigator)
18513341 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18513341 CCR2 haplotype 2 and HLA-DRB1*0301 are independent genetic risk factors for Lofgren's syndrome.
18391751 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18332000 The frequency of CCR2-64 I allele of 12 ethnic populations in China were lower than that of Han. The frequency of CCR2-64 I allele between Southern and South-east group showed significant variations.
18332000 Observational study of genotype prevalence. (HuGE Navigator)
18306985 Observational study of gene-disease association. (HuGE Navigator)
18197127 Results showed that the combination of 2 non-synonymous substitutions, CCR2 V64I and CCR5 G316A, tended to occur more frequently in ESN(exposed to HIV but seronegative) females than in HIV-1 infected females.
18197127 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18186797 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18186797 There was no difference in the incidence of rejection among renal transplant recipients stratified by the CCR2-V64I genotype.
18172114 No evidence was found of an association between TLR4, CCR2, and CCL2 and AMD (age-related macular degeneration)
18172114 Observational study of gene-disease association. (HuGE Navigator)
18164016 AGE-LDL can increase CCR2 expression in macrophages and stimulate the chemotactic response elicited by MCP-1.
18096169 The functionally relevant CCR2 promoter polymorphism T-960A (rs3918359) is associated with elevated vascular function.
18093816 Data show that MCP-1 has a synergistic effect on COX-2 and CCR2 protein expression in CD40L-stimulated HUVECs and stimulates VEGF production in these cells.
18060801 Observational study of gene-disease association. (HuGE Navigator)
18055544 MCP-1/CCR2 system is functionally active in podocytes and may be implicated in the migratory events triggered by podocyte injury in crescentic GN and other glomerular diseases
17989610 Observational study of gene-disease association. (HuGE Navigator)
17934338 the relatively higher expression of CCR2A on the cell surface suggests that this isoform of MCP-1 receptor functions as the principal mediator of inflammatory signals in RA FLS.
17917677 preliminary evidence linking genetic variation in CCR2 to circulating levels of MCP-1
17845302 Observational study of genotype prevalence. (HuGE Navigator)
17786209 Observational study of gene-disease association. (HuGE Navigator)
17715128 analysis of allosteric inhibition by CCR2/CXCR4 heterodimers
17704101 CCR2 and CCL2 are co-expressed by human first-trimester decidual stromal cells and decidual tissue.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17703277 Overexpression of CC chemokine receptor-2A (CCR2A) was seen in glioblastoma specimens localized in the cytoplasm, and pronounced CCR2A immunoreactivity in tumor-infiltrating area was associated with prior chemo/radiation therapy.
17688234 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17688234 The CCR-2 64I variant was associated with decreased risk of cervical cancer; homozygote carriers of the 64I variant had an odds ratio of 0.31 (0.12-0.77).
17672867 Observational study of gene-disease association. (HuGE Navigator)
17664883 The frequency of A carrier genotypes was higher in HSIL patients than in the controls suggesting that CCR2-64I polymorphism might contribute to the establishment of HSIL through the disruption of the naturally fragile immune response towards HPV infection
17653321 Observational study of gene-disease association. (HuGE Navigator)
17615573 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17604544 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17604544 the effect of CCR2b-64I polymorphisms on disease progression may differ according to the stage of HIV infection and interactions with other gene variants
17596666 Observational study of gene-disease association. (HuGE Navigator)
17596666 RANTES, MCP-1, CCR2, CCR5, CXCR1 and CXCR4 gene polymorphisms do not have a role in progression of hepatitis B virus infection
17560067 neither CCR5 nor CCR2 polymorphisms showed peculiar segregation with progressive multifocal leukoencephalopathy and/or non-determined leukoencephalopathy
17560067 Observational study of gene-disease association. (HuGE Navigator)
17504503 Observational study of gene-disease association. (HuGE Navigator)
17504503 no significant difference in allele or genotype distribution of CCR2 V64I polymorphism was observed in HIV-infected & healthy subjects indicating no association between CCR2 V64I polymorphism and susceptibility to HIV infection in North Indian population
17499741 Resveratrol inhibits monocyte CCR2 binding activity in an NO-, MAPK- and PI3K-dependent manner, whereas it inhibits CCR2 mRNA in an NO- and MAPK-independent, PI3K-dependent manner
17482150 Observational study of gene-disease association. (HuGE Navigator)
17482150 Single Nucleotide Polymorphisms (SNP) CCR2 gene showed highly significant signals with the number of coronary arteries with stenosis Korean male patients; most significant signal was detected at the SNP located at exon 2.
17465499 Observational study of gene-disease association. (HuGE Navigator)
17465499 Mutations studied in the gene pair CCL2/CCR2 do not play a major role in the outcome and response to treatment for HCV infection in the Spanish population.
17464174 These results demonstrate that 9-cis-Retinoic acid transduces the signal through p38 MAPK and ERK1/2 for CCR1 and CCR2 up-regulation.
17428349 Observational study of gene-disease association. (HuGE Navigator)
17426779 In this review we focus on the known polymorphisms of two chemokines: CCL2, CCL5 and their corresponding receptors (CCR2, CCR5) and we also discuss their associations with susceptibility and progression to selected immune-mediated diseases. [REVIEW]
17417600 Observational study of gene-disease association. (HuGE Navigator)
17413295 Observational study of gene-disease association. (HuGE Navigator)
17395051 The expression of FOUNT-mediated CCL2/CCR2 may have important implications in the pathogenesis of CHF. The CCL2/CCR2 pathway via FROUNT may influence the clinical severity of CHF.
17364026 CCR2 is critical for monocyte mobilization and suggests new roles for monocyte chemoattractants in leukocyte homeostasis
17361671 Observational study of gene-disease association. (HuGE Navigator)
17355643 Observational study of genotype prevalence. (HuGE Navigator)
17298432 the CCR2-64*I allele is more common in asthmatic patients, especially among atopic subjects
17295203 Mesenchymal stem cells express chemokine receptor CCR2 and migrate upon stimulation with IL-8.
17240189 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17216598 Results suggest that CCR2 may contribute to prostate cancer development.
17135764 Observational study of gene-disease association. (HuGE Navigator)
17094383 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17091019 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17060059 Observational study of gene-disease association. (HuGE Navigator)
17060059 evaluated the possible relation between CCR2 and CCR5 alleles and blood pressure (BP) levels in hypertensive
16950632 Observational study of gene-disease association. (HuGE Navigator)
16908772 In atherogenesis, oxidized lipid-driven activation of macrophage PPARgamma in the intima may result in a proadhesive chemokine receptor switch-CCR2 off.
16903979 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16865553 Observational study of gene-disease association. (HuGE Navigator)
16858645 Observational study of gene-disease association. (HuGE Navigator)
16831471 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
16781696 The mRNA expressions of CCR2 of all post-kidney transplant patients were significantly higher than controls.
16733654 Double immunofluorescense staining demonstrated that cellular sources of MCP-1/CCL2 and IP-10/CXCL10 were hypertrophic astrocytes and that both astrocytes and microglia/macrophages expressed CCR2 and CXCR3.
16631114 Our data suggest that elevated serum MCP-1 levels and increased monocyte CCR2, CD36, CD68 expression correlate with poor blood glucose control and potentially contribute to increased recruitment of monocytes to the vessel wall in diabetes mellitus.
16598837 Observational study of gene-disease association. (HuGE Navigator)
16598837 the risk of acute rejection in renal transplantation may be associated with genetic variation in the chemokine receptor genes CCR5-59029 and CCR2V641 in Turkey
16529059 Observational study of gene-disease association. (HuGE Navigator)
16524739 Observational study of gene-disease association. (HuGE Navigator)
16485782 Observational study of gene-disease association. (HuGE Navigator)
16480760 Observational study of gene-disease association. (HuGE Navigator)
16478397 Observational study of gene-disease association. (HuGE Navigator)
16461193 Observational study of gene-disease association. (HuGE Navigator)
16461193 results of the present study provide no evidence that either CCR5-Delta32 or CCR2-64I is associated with hypertension
16426243 Observational study of genotype prevalence. (HuGE Navigator)
16415174 These data suggest that fibrogenic processes in Mo regulated by MCP-1/CCR2 may be novel, therapeutic targets for combating organ fibrosis.
16356504 Observational study of gene-disease association. (HuGE Navigator)
16323127 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16320328 potential autocrine regulation of key profibrotic properties via a CCL2/CCR2 loop in early-stage diffuse cutaneous systemic sclerosis
16314800 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16305685 Observational study of gene-disease association. (HuGE Navigator)
16286055 Observational study of genotype prevalence. (HuGE Navigator)
16286054 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16261210 Observational study of gene-disease association. (HuGE Navigator)
16207551 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16206074 Observational study of gene-disease association. (HuGE Navigator)
16196460 Observational study of gene-disease association. (HuGE Navigator)
16140745 Observational study of gene-disease association. (HuGE Navigator)
16123688 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16095529 The results indicate that pulmonary CCR2+ T cells and MCP-1 contribute to the pathogenesis of pediatric ILD and might provide a novel target for therapeutic strategies.
16055130 Observational study of gene-disease association. (HuGE Navigator)
16055130 Genetic variation in CC-chemokine receptor-2 (CCR2) and -5 (CCR5), and their common haplotypes, acting through inflammatory responses, may affect atherosclerosis and risk of coronary heart disease (CHD).
16033640 These data suggest that the regulation of the CCL2 and CXCL10 expression exhibit significant differences in their mechanisms, and also demonstrate that the alveolar epithelium contributes to the cytokine milieu of the lung.
15992849 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
15980693 Observational study of gene-disease association. (HuGE Navigator)
15976001 subclinical clotting activation may cause an increased CCR2 gene and protein expression on uremic peripheral blood mononuclear cells, contributing to hemodialysis-related chronic microinflammation
15929697 Observational study of gene-disease association. (HuGE Navigator)
15863470 Observational study of gene-disease association. (HuGE Navigator)
15793370 Observational study of gene-disease association. (HuGE Navigator)
15769362 Observational study of gene-disease association. (HuGE Navigator)
15754978 Observational study of genotype prevalence. (HuGE Navigator)
15754978 Frequency distribution of CCR2-64I mutations in Brazilian Amazon region
15750046 Observational study of gene-disease association. (HuGE Navigator)
15750046 Did not support previous findings of an association between CCR2 gene variability and the risk of sarcoidosis; however, linkage disequilibrium showed positive results and suggests susceptibility gene in surrounding chromosomal region.
15721423 Observational study of gene-disease association. (HuGE Navigator)
15639953 Observational study of genotype prevalence. (HuGE Navigator)
15611878 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15602133 Observational study of gene-disease association. (HuGE Navigator)
15585333 Observational study of genotype prevalence. (HuGE Navigator)
15579296 Observational study of gene-disease association. (HuGE Navigator)
15579296 The impact of CCR2 on neuropathogenesis may involve alterations in inflammatory responses within the CNS rather than a direct impact on viral entry or replication.
15575507 Observational study of genotype prevalence. (HuGE Navigator)
15488313 Observational study of gene-disease association. (HuGE Navigator)
15472820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15466648 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15465089 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15465089 A decreased frequency and an absence of homozygous for the polymorphism CCR2-64I were found.
15458467 Observational study of gene-disease association. (HuGE Navigator)
15362666 Observational study of gene-disease association. (HuGE Navigator)
15319853 Observational study of gene-disease association. (HuGE Navigator)
15257681 Our findings suggest a limited role for CCL2/CCR2 in early active multiple sclerosis
15236615 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15230854 Observational study of gene-disease association. (HuGE Navigator)
15192276 Observational study of gene-disease association. (HuGE Navigator)
15140377 Observational study of genotype prevalence. (HuGE Navigator)
15135805 Observational study of gene-disease association. (HuGE Navigator)
15086398 Observational study of gene-disease association. (HuGE Navigator)
15086346 Observational study of gene-disease association. (HuGE Navigator)
15076247 Observational study of genotype prevalence. (HuGE Navigator)
15053339 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
14981141 Observational study of gene-disease association. (HuGE Navigator)
14742283 Observational study of gene-disease association. (HuGE Navigator)
14647058 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14644039 Observational study of gene-disease association. (HuGE Navigator)
14644039 The presence of the CCR2-64I allele in a Japanese population seems to provide protection against the development of multiple sclerosis.
14624371 Observational study of gene-disease association. (HuGE Navigator)
14533983 Observational study of genotype prevalence. (HuGE Navigator)
14533004 Observational study of gene-disease association. (HuGE Navigator)
14533004 A PCR-based genotyping method was used to determine the genetic variation at the CCR5 gene and an automated real-time Pyrosequencing technology was employed for the analysis of G right curved arrow A point mutation at the CCR2 gene
13678532 Angiotensin II significantly stimulated superoxide formation in monocytes, as well as the chemotactic response to MCP-1 with the increased expression of monocyte chemoattractant protein 1 receptor determined by RT-PCR and western blotting analysis
12913933 Observational study of gene-disease association. (HuGE Navigator)
12913933 Polymorphisms of CCR2 and CCR5 do not seem to be involved in susceptibility to systemic lupus erythematosis
12889997 Observational study of gene-disease association. (HuGE Navigator)
12884524 Observational study of genotype prevalence. (HuGE Navigator)
12884524 The calculation of the congruence revealed that 92.0% of individuals exhibited the same genotype for both CCR2-64I and CCR5-59653T polymorphisms. Our results confirm that linkage between CCR5-59653T and CCR2-64I alleles is not absolute.
12882757 Observational study of gene-disease association. (HuGE Navigator)
12853745 Meta-analysis of gene-disease association. (HuGE Navigator)
12853162 Observational study of gene-disease association. (HuGE Navigator)
12853162 females with the VI genotype were seven times more prone to suffer from myocardial infarction before 50 years than those with the VV genotype
12837756 activation of CCR5 and CCR2 is induced by conformational changes in the conserved TXP motif in transmembrane helix 2
12719858 Observational study of gene-disease association. (HuGE Navigator)
12719858 CCR2 genotype seems to predispose patients for myocardial infarction before the age of 65 years; the higher prevalence of heart failure in gene carriers with the rare alle might be a consequence of myocardial infarction
12680626 Observational study of gene-disease association. (HuGE Navigator)
12654703 Observational study of gene-disease association. (HuGE Navigator)
12651900 The specific distribution and regulation of chemokine receptors CXCR1, CXCR4, CCR5, and CCR2b in endometrial epithelium and blastocyst suggest a role for these receptors in the apposition and adhesion phases of human implantation.
12584049 Clinical trial of gene-environment interaction. (HuGE Navigator)
12571520 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12557141 Observational study of gene-disease association. (HuGE Navigator)
12556692 Observational study of gene-disease association. (HuGE Navigator)
12469616 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12469616 Polymorphism is associated with myocardial infarct.
12447757 Observational study of gene-disease association. (HuGE Navigator)
12436194 Observational study of genotype prevalence. (HuGE Navigator)
12426226 Observational study of gene-disease association. (HuGE Navigator)
12426226 Val64Ile polymorphism in the C-C chemokine receptor 2 is associated with reduced coronary artery calcification.
12403355 Observational study of gene-disease association. (HuGE Navigator)
12403355 C-C chemokine receptor 2 and C-C chemokine receptor 5 genotypes in patients treated for chronic hepatitis C virus infection.
12399623 Results show that high ambient glucose does not affect mesangial monocyte chemoattractant protein-1 release and decreases its chemokine receptor 2 (CCR2) receptor expression.
12374865 Observational study of gene-disease association. (HuGE Navigator)
12239249 Observational study of gene-disease association. (HuGE Navigator)
12215924 Observational study of gene-disease association. (HuGE Navigator)
12201365 Observational study of gene-disease association. (HuGE Navigator)
12192431 Electrostatic potential maps of human and primate CCR2b all display the dipolar characteristics of CCR2b with the negative pole located in the extracellular part and a strong positive pole in the cytoplasmic part.
12192431 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12079277 Observational study of gene-disease association. (HuGE Navigator)
12079277 May be a new candidate for a susceptibility locus for bone mass in middle-aged men and postmenopausal women
12078856 expression of CCR2B in aiway epithelial cells after injury enhances cell migration and proliferation
12070001 Most natural killer t-cells express receptors for extralymphoid tissue or inflammation-related chemokines (CCR2, CCR5, and CXCR3), while few NKT cells express lymphoid tissue-homing chemokine receptors (CCR7 and CXCR5).
12032878 Observational study of gene-disease association. (HuGE Navigator)
12010355 Observational study of gene-disease association. (HuGE Navigator)
12001056 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11988632 Observational study of genotype prevalence. (HuGE Navigator)
11964548 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11958683 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11898620 Observational study of genotype prevalence. (HuGE Navigator)
11898620 The frequencies of CCR2 mutation associated with the development of clinical symptoms upon infection with human immunodeficiency virus type 1 (HIV-1) were determined in a cohort of individuals from Moscow.
11873083 CCR2 641 allele homozygosity implicated in natural resistance to HIV-1 transmission through heterosexual contact
11860823 Observational study of genotype prevalence. (HuGE Navigator)
11860793 Observational study of genotype prevalence. (HuGE Navigator)
11856781 Observational study of gene-disease association. (HuGE Navigator)
11804551 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
11756347 Observational study of gene-disease association. (HuGE Navigator)
11752157 Observational study of gene-disease association. (HuGE Navigator)
11752157 genotypes and their relative contribution to human immunodeficiency virus type 1 (HIV-1) seroconversion, early HIV-1 RNA concentration in plasma, and later disease progression
11729511 Observational study of genotype prevalence. (HuGE Navigator)
11709782 Observational study of gene-disease association. (HuGE Navigator)
11709782 Association of CCR2 genotype with disease progression of HIV infection
11696224 Observational study of genotype prevalence. (HuGE Navigator)
11694103 Meta-analysis of gene-disease association. (HuGE Navigator)
11596075 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11500196 Observational study of gene-disease association. (HuGE Navigator)
11485615 Observational study of gene-disease association. (HuGE Navigator)
11477473 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11468722 Observational study of gene-disease association. (HuGE Navigator)
11385319 Observational study of genotype prevalence. (HuGE Navigator)
11377705 Observational study of gene-disease association. (HuGE Navigator)
11175286 Observational study of genotype prevalence. (HuGE Navigator)
11115360 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
11023492 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
10877489 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
10751368 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
10486323 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
9789057 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
9736741 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
9653051 HIV-1 Tat upregulates the expression of CCR2,CD16, and TLR-4 in monocyte-derived macrophages
8995400 There are two splicing variants for human CCR2. One is NM_000647/NP_000638 (CCR2A) and the other is NM_000648/NP_000639 (CCR2B). See OMIM 601267 for details.

AA Sequence

MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINC      1 - 70
KKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYL     71 - 140
AIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILG    141 - 210
LVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCEST    211 - 280
SQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL    281 - 350
LDGRGKGKSIGRAPEASLQDKEGA                                                  351 - 374
//

Text Mined References (421)

PMID Year Title
27534043 2010 [STUDY OF CHEMOKINE RECEPTOR CCR2 GENE POLYMORPHISM IN PATIENTS WITH ASTHMA AND THEIR RELATIVES].
27239844 [Gene Polymorphism of the c-fms, ITGB3,CCR2, and DBH genes in the populations of old believers of the Tyumen oblast and Russian residents of Novosibirsk].
26982176 2016 CCR2 and CCR5 genes polymorphisms in women with cervical lesions from Pernambuco, Northeast Region of Brazil: a case-control study.
26648448 2016 N-methyl-N-nitro-N'-nitrosoguanidine induces the expression of CCR2 in human gastric epithelial cells promoting CCL2-mediated migration.
26300579 2015 Chemokine Coreceptor-2 Gene Polymorphisms among HIV-1 Infected Individuals in Kenya.
26211665 2015 Haptoglobin and CCR2 receptor expression in ovarian cancer cells that were exposed to ascitic fluid: exploring a new role of haptoglobin in the tumoral microenvironment.
26123579 2015 Association of hydrogen sulfide with alterations of monocyte chemokine receptors, CCR2 and CX3CR1 in patients with coronary artery disease.
25966143 2015 Relationship between genetic polymorphisms in MCP-1, CCR-2, and non-small-cell lung cancer in the Han nationality of Northern China.
25808810 2015 Senescent dermal fibroblasts enhance stem cell migration through CCL2/CCR2 axis.
25797207 2015 CCR2-64I polymorphism is associated with Non-Small Cell Lung Cancer in Tunisian patients.
25779331 2015 CCR2 Expression in Neutrophils Plays a Critical Role in Their Migration Into the Joints in Rheumatoid Arthritis.
25760842 2015 [Association of CCR2 gene rs1799864 polymorphism with hemophagocytic lymphohistiocytosis in children].
25614627 2015 Biased signaling at chemokine receptors.
25604634 2015 The +190 G/A (rs1799864) polymorphism in the C-C chemokine receptor 2 (CCR2) gene is associated with susceptibility to multiple sclerosis in HLA-DRB1*15:01-negative individuals.
25503251 2014 CX3CL1/CX3CR1 and CCL2/CCR2 chemokine/chemokine receptor complex in patients with AMD.
25411969 2014 Increased C-C chemokine receptor 2 gene expression in monocytes of severe obstructive sleep apnea patients and under intermittent hypoxia.
25370917 2015 MCP-1 and CCR2 gene polymorphisms in Parkinson's disease in a Han Chinese cohort.
25340798 2014 Genome-wide association study of CSF levels of 59 alzheimer's disease candidate proteins: significant associations with proteins involved in amyloid processing and inflammation.
25313609 2014 CCR2, CX3CR1, RANTES and SDF1 genetic polymorphisms influence HIV infection in a Zimbabwean pediatric population.
25312961 2015 The chemokine (CCL2-CCR2) signaling axis mediates perineural invasion.
25312802 2014 SNP/haplotype associations of CCR2 and CCR5 genes with severity of chagasic cardiomyopathy.
25283965 2014 Structural basis for the binding of the membrane-proximal C-terminal region of chemokine receptor CCR2 with the cytosolic regulator FROUNT.
25266801 2015 Genetic variants of chemokine CCL2 and chemokine receptor CCR2 genes and risk of prostate cancer.
25261725 2014 Human cytomegalovirus replication supported by virus-induced activation of CCL2-CCR2 interactions.
25149422 2014 Discrepancy in CCL2 and CCR2 expression in white versus grey matter hippocampal lesions of Multiple Sclerosis patients.
25139016 2015 Intermediate monocytes contribute to pathologic immune response in Leishmania braziliensis infections.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24984897 2014 Role of CCR2 in inflammatory conditions of the central nervous system.
24970887 2014 Unique properties of human ?-defensin 6 (hBD6) and glycosaminoglycan complex: sandwich-like dimerization and competition with the chemokine receptor 2 (CCR2) binding site.
24778447 2014 Cross-desensitization of CCR1, but not CCR2, following activation of the formyl peptide receptor FPR1.
24639350 2014 CCL2 shapes macrophage polarization by GM-CSF and M-CSF: identification of CCL2/CCR2-dependent gene expression profile.
24453913 2013 Investigation of chemokine receptor CCR2V64Il gene polymorphism and migraine without aura in the Iranian population.
24406043 2013 RNAi targeting of CCR2 gene expression induces apoptosis and inhibits the proliferation, migration, and invasion of PC-3M cells.
24344240 2014 IL-33 enhances proliferation and invasiveness of decidual stromal cells by up-regulation of CCL2/CCR2 via NF-?B and ERK1/2 signaling.
24332572 2014 A blood-based three-gene signature for the non-invasive detection of early human hepatocellular carcinoma.
24327013 2014 Brain metastasis in renal cancer patients: metastatic pattern, tumour-associated macrophages and chemokine/chemoreceptor expression.
24185682 2014 Chemokine-chemokine receptor CCL2-CCR2 and CX3CL1-CX3CR1 axis may play a role in the aggravated inflammation in primary biliary cirrhosis.
24128342 2014 Identification of a binding element for the cytoplasmic regulator FROUNT in the membrane-proximal C-terminal region of chemokine receptors CCR2 and CCR5.
24098976 2013 Influence of CCR5 and CCR2 genetic variants in the resistance/susceptibility to HIV in serodiscordant couples from Colombia.
24083412 2014 Functional genetic polymorphisms of monocyte chemoattractant protein 1 and C-C chemokine receptor type 2 in ischemic stroke.
24078580 2013 [Association of chemokines and their receptors genes polymorphisms with risk of myocardial infarction].
24011637 2013 Genetic diversity and linkage disequilibrium in the chemokine receptor CCR2-CCR5 region among individuals and populations.
23922698 2013 Mechanisms of HIV entry into the CNS: increased sensitivity of HIV infected CD14+CD16+ monocytes to CCL2 and key roles of CCR2, JAM-A, and ALCAM in diapedesis.
23880174 2013 Distribution of CCR5-Delta32, CCR5 promoter 59029 A/G, CCR2-64I and SDF1-3'A genetic polymorphisms in HIV-1 infected and uninfected patients in the west region of Cameroon.
23876399 2013 Association of polymorphisms in the MCP-1 and CCR2 genes with the risk of cancer: a meta-analysis.
23846739 2013 The multiple faces of CCL13 in immunity and inflammation.
23771498 2013 Role of chemokine CCL2 and its receptor CCR2 in neurodegenerative diseases.
23727176 Possible contribution of chemokine receptor CCR2 and CCR5 polymorphisms in the pathogenesis of chronic spontaneous autoreactive urticaria.
23686489 2013 Protective role of the inflammatory CCR2/CCL2 chemokine pathway through recruitment of type 1 cytotoxic ?? T lymphocytes to tumor beds.
23657965 2013 Monocyte chemotactic protein-1 and CC chemokine receptor 2 polymorphisms and prognosis of renal cell carcinoma.
23632061 2013 CCR2 and CCR5 genes polymorphisms in benign prostatic hyperplasia and prostate cancer.
23612252 2013 Relationship between CCR2-V64I polymorphism and cancer risk: a meta-analysis.
23454776 2013 MCP-1, CCR2 and CCR5 polymorphisms in Tunisian patients with atopic asthma.
23427179 2013 Relationships of single nucleotide polymorphisms of monocyte chemoattractant protein 1 and chemokine receptor 2 with susceptibility and clinicopathologic characteristics of neoplasia of uterine cervix in Taiwan women.
23408426 2013 Tyrosine sulfation of chemokine receptor CCR2 enhances interactions with both monomeric and dimeric forms of the chemokine monocyte chemoattractant protein-1 (MCP-1).
23376609 2013 Absence of CC chemokine receptors 2a and 2b from human adipose lineage cells.
23374597 2013 Association of monocyte CCR2 expression with obesity and insulin resistance in postmenopausal women.
23325742 2013 Impact of CCR2 and SDF1 polymorphisms on disease progression in HIV-infected subjects in Thailand.
23298254 2013 Peripheral monocyte expression of the chemokine receptors CCR2, CCR5 and CXCR3 is altered at parturition in healthy women and in women with systemic lupus erythematosus.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23185512 2012 The CCL2/CCR2 axis enhances vascular cell adhesion molecule-1 expression in human synovial fibroblasts.
23185481 2012 Single nucleotide polymorphisms in MCP-1 and its receptor are associated with the risk of age related macular degeneration.
23090289 2013 Expression of monocyte chemoattractant protein-1 and CC chemokine receptor 2 in non-small cell lung cancer and its significance.
23057571 2012 The genetic associations and epistatic effects of the CCR5 promoter and CCR2-V64I polymorphisms on susceptibility to HIV-1 infection in a Northern Han Chinese population.
23041556 2012 The effect of chemokine receptor gene polymorphisms (CCR2V64I, CCR5-59029G>A and CCR5?32) on renal allograft survival in Pakistani transplant patients.
23007133 2012 The monocyte chemoattractant protein-1 (MCP-1)/CCR2 system is involved in peritoneal dialysis-related epithelial-mesenchymal transition of peritoneal mesothelial cells.
22927430 2012 CCL2/CCR2 chemokine signaling coordinates survival and motility of breast cancer cells through Smad3 protein- and p42/44 mitogen-activated protein kinase (MAPK)-dependent mechanisms.
22909007 2013 Structure prediction and molecular dynamics simulations of a G-protein coupled receptor: human CCR2 receptor.
22815949 2012 Novel process of intrathymic tumor-immune tolerance through CCR2-mediated recruitment of Sirp?+ dendritic cells: a murine model.
22752804 2012 Impact of MCP-1 and CCR-2 gene polymorphisms on coronary artery disease susceptibility.
22685564 2012 Possible association between expression of chemokine receptor-2 (CCR2) and amyotrophic lateral sclerosis (ALS) patients of North India.
22615942 2012 CCR2 acts as scavenger for CCL2 during monocyte chemotaxis.
22612293 2012 Association of polymorphisms in MCP-1, CCR2, and CCR5 genes with the risk and clinicopathological characteristics of prostate cancer.
22607625 2012 Leukocyte CCR2 expression is associated with mini-mental state examination score in older adults.
22554651 2012 Genetic polymorphisms of CCL2, CCL5, CCR2 and CCR5 genes in Sahariya tribe of North Central India: an association study with pulmonary tuberculosis.
22479344 2012 Structural insights from binding poses of CCR2 and CCR5 with clinically important antagonists: a combined in silico study.
22285384 2012 Polymorphisms in the CC-chemokine receptor-2 (CCR2) and -5 (CCR5) genes and risk of myocardial infarction among Tunisian male patients.
22276574 2012 The association of monocyte chemotactic protein-1 and CC chemokine receptor 2 gene variants with chronic obstructive pulmonary disease.
22226505 2012 CCL2 binding is CCR2 independent in primary adult human astrocytes.
22218121 2012 Chemokine receptor 2-V64I and chemokine receptor 5-Delta32 polymorphisms and clinical risk factors of delayed graft function and acute rejection in kidney transplantation.
22197827 2012 MCP-1/CCR-2-double-deficiency severely impairs the migration of hematogenous inflammatory cells following transient cerebral ischemia in mice.
22183310 2012 Local vs. systemic mononuclear phagocytes in age-related macular degeneration and their regulation by CCL2-CCR2 and CX3CL1-CX3CR1 chemokine signalling.
22159219 2012 A dialog between glioma and microglia that promotes tumor invasiveness through the CCL2/CCR2/interleukin-6 axis.
22081934 2012 MCP-1 and CCR2 gene variants and the risk for osteoporosis and osteopenia.
22041342 2011 CCR2 polymorphism in chronic renal failure patients requiring long-term hemodialysis.
22026334 2011 Chemokine and chemokine receptor gene polymorphism in Tunisian hemodialysis patients with HCV infection.
21890375 2011 Adiponectin stimulates release of CCL2, -3, -4 and -5 while the surface abundance of CCR2 and -5 is simultaneously reduced in primary human monocytes.
21883707 2012 MCP-1 and CCR2 gene variants in oral squamous cell carcinoma.
21868018 2011 Genetic variants of the monocyte chemoattractant protein-1 gene and its receptor CCR2 and risk of coronary artery disease: a meta-analysis.
21682549 2012 Effects of C-reactive protein on CC chemokine receptor 2-mediated chemotaxis of monocytes.
21667221 2012 The Consequence of a Founder Effect: CCR5-?32, CCR2-64I and SDF1-3'A Polymorphism in Vlach Gypsy Population in Hungary.
21602126 2011 [Association of CCR5, CCR2 and SDF1 gene polymorphisms with HIV-1 infection in Chinese population: a meta-analysis].
21570337 2011 CCR2-64I gene polymorphism increase susceptibility to oral cancer.
21527853 2011 Blockage of TNF-? by infliximab reduces CCL2 and CCR2 levels in patients with rheumatoid arthritis.
21461583 Association between the CCR2-Val64Ile polymorphism and susceptibility to HIV-1 infection: a meta-analysis.
21450101 2011 In vitro migration of cytotoxic T lymphocyte derived from a colon carcinoma patient is dependent on CCL2 and CCR2.
21440726 2011 Genetic polymorphisms of inflammatory molecules in Tunisian kidney transplantation.
21429204 2011 Association of chemokine receptor gene (CCR2-CCR5) haplotypes with acquisition and control of HIV-1 infection in Zambians.
21396623 2011 Association of host genetic risk factors with the course of cytomegalovirus retinitis in patients infected with human immunodeficiency virus.
21348591 2011 Role of CCR2 and IL-8 in acute lung injury: a new mechanism and therapeutic target.
21322034 2011 Identification of CCR2-binding features in Cytl1 by a CCL2-like chemokine model.
21264360 2010 Combined association of CCR2-V64I and MCP-1-2518A/G polymorphisms with generalised aggressive periodontitis in Chinese.
21220372 2011 The role of the CCR2 gene polymorphism in abdominal aortic aneurysms.
21148810 2011 TLR2-dependent pathway of heterologous down-modulation for the CC chemokine receptors 1, 2, and 5 in human blood monocytes.
21146687 2011 Differential effect of telmisartan and amlodipine on monocyte chemoattractant protein-1 and peroxisome proliferator-activated receptor-gamma gene expression in peripheral monocytes in patients with essential hypertension.
21097672 2011 Osteoclast-gene expression profiling reveals osteoclast-derived CCR2 chemokines promoting myeloma cell migration.
21097527 2011 MCP-1/CCR2B-dependent loop upregulates MUC5AC and MUC5B in human airway epithelium.
21091093 2011 Polymorphisms in chemokine and receptor genes and gastric cancer risk and survival in a high risk Polish population.
21054877 2010 Inflammation gene variants and susceptibility to albuminuria in the U.S. population: analysis in the Third National Health and Nutrition Examination Survey (NHANES III), 1991-1994.
20947712 2010 CCL2 and CCR2 variants are associated with skeletal muscle strength and change in strength with resistance training.
20842059 2010 Enhanced tumor trafficking of GD2 chimeric antigen receptor T cells by expression of the chemokine receptor CCR2b.
20808917 2010 Filamin a binds to CCR2B and regulates its internalization.
20740585 2010 Genetic polymorphism of CCR2-64I increased the susceptibility of hepatocellular carcinoma.
20726788 2010 Association of monocyte chemotactic protein-1 and CC chemokine receptor 2 gene variants with preeclampsia.
20681057 2010 The role of monocyte chemoattractant protein MCP1/CCL2 in neuroinflammatory diseases.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20637631 2010 Lack of association between monocyte protein-1 (MCP-1) -2518 A>G chemoattractant and C-C chemokine receptor 2 (CCR2) Val64Ile polymorphisms and multiple sclerosis in a Tunisian population.
20628649 2010 Association of CCR2-CCR5 haplotypes and CCL3L1 copy number with Kawasaki Disease, coronary artery lesions, and IVIG responses in Japanese children.
20605053 Importance of CCL2-CCR2A/2B signaling for monocyte migration into spheroids of breast cancer-derived fibroblasts.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20537184 2010 CCR2-V64I polymorphism is associated with increased risk of cervical cancer but not with HPV infection or pre-cancerous lesions in African women.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20531015 2010 Effect of host genetics on incidence of HIV neuroretinal disorder in patients with AIDS.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20483750 2010 Human beta-defensin 2 and 3 and their mouse orthologs induce chemotaxis through interaction with CCR2.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20449800 2010 CCR2-64I is a risk factor for development of bladder cancer.
20442634 2010 APOE epsilon4 and MBL-2 O/O genotypes are associated with neurocognitive impairment in HIV-infected plasma donors.
20411675 2010 HIV infection and host genetic mutation among injecting drug-users of northeastern states of India.
20364004 Association of CCL2 and CCR2 gene variants with endometrial cancer in Turkish women.
20339010 2010 CCL2 and CCR2 polymorphisms are associated with markers of exercise-induced skeletal muscle damage.
20231199 2010 Association of the MCP-1 -2518 A/G polymorphism and no association of its receptor CCR2 -64 V/I polymorphism with lupus nephritis.
20220260 Linkage and haplotype analysis for chemokine receptors clustered on chromosome 3p21.3 and transmitted in family pedigrees with asthma and atopy.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20182805 2010 Effect of genetic variants of chemokine receptors on the development of myocardial infarction in Turkish population.
20181074 2010 CCR2 and coronary artery disease: a woscops substudy.
20153665 2010 Genetic variation at the CCR5/CCR2 gene cluster and risk of psoriasis and psoriatic arthritis.
20066125 2009 Screening the single nucleotide polymorphisms in patients with internal carotid artery stenosis by oligonucleotide-based custom DNA array.
20038229 2010 Chemokine polymorphisms and lymphoma: a pooled analysis.
20017911 2009 The obesity and inflammatory marker haptoglobin attracts monocytes via interaction with chemokine (C-C motif) receptor 2 (CCR2).
19965779 2010 Pharmacological inhibition of C-C chemokine receptor 2 decreases macrophage infiltration in the aortic root of the human C-C chemokine receptor 2/apolipoprotein E-/- mouse: magnetic resonance imaging assessment.
19958843 2010 Distribution of CCR5-Delta32, CCR5m303A, CCR2-64I and SDF1-3'A in HIV-1 infected and uninfected high-risk Uighurs in Xinjiang, China.
19950235 2010 Do human polyoma viruses and human immunodeficiency virus share common co-receptors?
19942750 2009 CCR2, MCP-1, SDF-1a & DC-SIGN gene polymorphisms in HIV-1 infected patients with & without tuberculosis.
19904283 2010 Role of chemokines in CNS health and pathology: a focus on the CCL2/CCR2 and CXCL8/CXCR2 networks.
19841162 2009 FROUNT is a common regulator of CCR2 and CCR5 signaling to control directional migration.
19720836 2009 Chemokine (C-C motif) ligand 2 engages CCR2+ stromal cells of monocytic origin to promote breast cancer metastasis to lung and bone.
19693089 2010 Four novel coeliac disease regions replicated in an association study of a Swedish-Norwegian family cohort.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19669591 2010 CCR2-64I allele is associated with the progression of AIDS in a Han Chinese population.
19643177 2009 Inhibition of dynamin prevents CCL2-mediated endocytosis of CCR2 and activation of ERK1/2.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19535619 2009 A novel recombinant fusion protein encoding a 20-amino acid residue of the third extracellular (E3) domain of CCR2 neutralizes the biological activity of CCL2.
19527467 2009 C-C chemokine receptor 2 expression by circulating monocytes influences atherosclerosis in patients on chronic hemodialysis.
19520154 2009 Genetic contribution of chemokine receptor 2 (CCR2) polymorphisms towards increased serum total IgE levels in Indian asthmatics.
19506371 2009 Single nucleotide polymorphisms in monocyte chemoattractant protein-1 and its receptor act synergistically to increase the risk of carotid atherosclerosis.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19465829 2009 CCR2-64I polymorphism is associated with lower maternal HIV-1 viral load and reduced vertical HIV-1 transmission.
19433914 2009 Sequence variants of chemokine receptor genes and susceptibility to HIV-1 infection.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19411748 2009 [Change of serum MCP-1 level and CCR2 protein expression in isolated monocytes in patients with acute coronary syndrome].
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19225544 2009 Variation in the lymphotoxin-alpha/tumor necrosis factor locus modifies risk of erythema nodosum in sarcoidosis.
19196047 2009 Cytokine (IL-10 -1082 and -819) and chemokine receptor (CCR2 and CCR5) gene polymorphism in North Indian patients with end-stage renal disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19124913 2008 Distribution of HIV-1 resistant polymorphisms among HIV infected patients in Georgia.
19098363 2008 Association of CCR5-59029 A/G and CCR2-V64I variants with renal allograft survival.
19082218 2008 Association and preferential transmission of the CCR2V64I polymorphism with absence of asthma in high-risk families.
19064579 2008 No association between common chemokine and chemokine receptor gene variants and prostate cancer risk.
19055601 2009 MCP-1 and CCR2 gene polymorphisms in Czech patients with allergic disorders.
19037908 2009 Impact of chemokine receptor CCR2 and CCR5 gene polymorphism on allograft outcome in North Indian renal transplant recipients.
19032065 2008 Distribution of CCR5-Delta32, CCR2-64I, SDF1-3'A, CX3CR1-249I, and CX3CR1-280M in Chinese populations.
19028820 2009 Polymorphisms in inflammatory genes and the risk of ischemic stroke and transient ischemic attack: results of a multilocus genotyping assay.
19017998 2008 Infiltrated neutrophils acquire novel chemokine receptor expression and chemokine responsiveness in chronic inflammatory lung diseases.
19002595 2009 Activation of MCP-1/CCR2 axis promotes prostate cancer growth in bone.
18996288 2008 Contribution of TNF-308A and CCL2-2518A to carotid intima-media thickness in obese mexican children and adolescents.
18977759 2008 Role of CC chemokine receptor 2 in bone marrow cells in the recruitment of macrophages into obese adipose tissue.
18974840 2008 Identification of novel single nucleotide polymorphisms in inflammatory genes as risk factors associated with trachomatous trichiasis.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18928397 2008 Short communication: SDF1-3'A gene mutation is correlated with increased susceptibility to HIV type 1 infection by sexual transmission in Han Chinese.
18855658 2008 Better CD4+ T cell recovery in Brazilian HIV-infected individuals under HAART due to cumulative carriage of SDF-1-3'A, CCR2-V64I, CCR5-D32 and CCR5-promoter 59029A/G polymorphisms.
18846510 2008 Chemokine receptor CCR2 undergoes transportin1-dependent nuclear translocation.
18845960 2008 Associations of chemokine receptor polymorphisms With HIV-1 mother-to-child transmission in sub-Saharan Africa: possible modulation of genetic effects by antiretrovirals.
18829011 2009 Monocyte chemotactic protein-1 (MCP-1), its receptor, and macrophages in the perifollicular stroma during the human ovulatory process.
18763111 2000 Provincial distribution of three HIV-1 resistant polymorphisms (CCR5-Delta32, CCR2-64I, and SDF1-3' A) in China.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18615095 2008 A polymorphism in the CCL2 chemokine gene is associated with asthma risk: a case-control and a family study in Tunisia.
18587271 2008 Human LZIP induces monocyte CC chemokine receptor 2 expression leading to enhancement of monocyte chemoattractant protein 1/CCL2-induced cell migration.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18513341 2008 A common haplotype of the C-C chemokine receptor 2 gene and HLA-DRB1*0301 are independent genetic risk factors for Löfgren's syndrome.
18391751 2008 Host genetic influences on highly active antiretroviral therapy efficacy and AIDS-free survival.
18332000 2008 [Distribution of HIV/AIDS associated CCR2-64 I allele of 14 Chinese ethnic populations in South China].
18306985 2008 RANTES-403 polymorphism is associated with reduced risk of gastric cancer in women.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18197127 2008 Effects of CCR2 and CCRS polymorphisms on HIV-1 infection in Thai females.
18186797 2008 Association of MCP-1 and CCR2 polymorphisms with the risk of late acute rejection after renal transplantation in Korean patients.
18172114 2008 Comprehensive analysis of the candidate genes CCL2, CCR2, and TLR4 in age-related macular degeneration.
18164016 2008 Glycated LDL increases monocyte CC chemokine receptor 2 expression and monocyte chemoattractant protein-1-mediated chemotaxis.
18096169 2008 The CCR2 promoter polymorphism T-960A, but not the serum MCP-1 level, is associated with endothelial function in prediabetic individuals.
18093816 2008 COX-2 and CCR2 induced by CD40 ligand and MCP-1 are linked to VEGF production in endothelial cells.
18060801 2008 Genetic control of chemokines in severe human internal carotid artery stenosis.
18055544 2007 The monocyte chemoattractant protein-1/cognate CC chemokine receptor 2 system affects cell motility in cultured human podocytes.
17989610 2007 Genetic variability of major inflammatory mediators has no impact on the outcome of kidney transplantation.
17934338 2007 Expression of CCR2A, an isoform of MCP-1 receptor, is increased by MCP-1, CD40 ligand and TGF-beta in fibroblast like synoviocytes of patients with RA.
17917677 2007 Circulating MCP-1 levels shows linkage to chemokine receptor gene cluster on chromosome 3: the NHLBI family heart study follow-up examination.
17845302 2007 Polymorphisms in CCR5 chemokine receptor gene in Japan.
17786209 2007 CCR5 haplotypes and mother-to-child HIV transmission in Malawi.
17715128 2007 Allosteric transinhibition by specific antagonists in CCR2/CXCR4 heterodimers.
17704101 2007 Regulation of C-C motif chemokine ligand 2 and its receptor in human decidual stromal cells by pregnancy-associated hormones in early gestation.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17703277 2008 CC chemokine receptor-2A is frequently overexpressed in glioblastoma.
17688234 2007 Variants of chemokine receptor 2 and interleukin 4 receptor, but not interleukin 10 or Fas ligand, increase risk of cervical cancer.
17672867 2007 Polymorphisms in chemokine receptor genes and susceptibility to Kawasaki disease.
17664883 2007 The influence of chemokine receptor CCR2 genotypes in the route to cervical carcinogenesis.
17653321 2007 [Association between sequence variation of Env, Gag genes from the same source and HIV-1 disease progression and host genetic polymorphism].
17615573 2007 Analysis of multiple SNPs in genetic association studies: comparison of three multi-locus methods to prioritize and select SNPs.
17604544 2007 CCR2b-64I allelic polymorphisms in advanced HIV-infected Koreans accelerate disease progression.
17596666 2007 RANTES, MCP-1, CCR2, CCR5, CXCR1 and CXCR4 gene polymorphisms are not associated with the outcome of hepatitis B virus infection: results from a large scale single ethnic population.
17560067 2008 Analysis of CCR5, CCR2, SDF1 and RANTES gene polymorphisms in subjects with HIV-related PML and not determined leukoencephalopathy.
17504503 2007 Distribution of CCR2 polymorphism in HIV-1-infected and healthy subjects in North India.
17499741 2007 Resveratrol inhibits expression and binding activity of the monocyte chemotactic protein-1 receptor, CCR2, on THP-1 monocytes.
17482150 2007 Association of CCR2 polymorphisms with the number of closed coronary artery vessels in coronary artery disease.
17465499 2007 CCL2-2518 A/G and CCR2 190 A/G do not influence the outcome of hepatitis C virus infection in the Spanish population.
17464174 2007 p38 MAPK and ERK activation by 9-cis-retinoic acid induces chemokine receptors CCR1 and CCR2 expression in human monocytic THP-1 cells.
17428349 2007 Association of TGFbeta1, TNFalpha, CCR2 and CCR5 gene polymorphisms in type-2 diabetes and renal insufficiency among Asian Indians.
17426779 2006 Polymorphisms in CCL2&CCL5 chemokines/chemokine receptors genes and their association with diseases.
17417600 2007 Polymorphisms of chemokine and chemokine receptor genes in idiopathic immune-mediated posterior segment uveitis.
17413295 2007 Lack of association of some chemokine system polymorphisms with the risks of death and hepatocellular carcinoma occurrence in patients with alcoholic cirrhosis: a prospective study.
17395051 2007 A novel activator of C-C chemokine, FROUNT, is expressed with C-C chemokine receptor 2 and its ligand in failing human heart.
17364026 2007 Critical roles for CCR2 and MCP-3 in monocyte mobilization from bone marrow and recruitment to inflammatory sites.
17361671 2006 Effects of polymorphisms of chemokine receptors on neurodevelopment and the onset of encephalopathy in children with perinatal HIV-1 infection.
17355643 2007 Frequencies of single nucleotide polymorphisms in genes regulating inflammatory responses in a community-based population.
17298432 2007 Association between a genetic variation of CC chemokine receptor-2 and atopic asthma.
17295203 2007 Towards in situ tissue repair: human mesenchymal stem cells express chemokine receptors CXCR1, CXCR2 and CCR2, and migrate upon stimulation with CXCL8 but not CCL2.
17240189 2007 Distribution of CCR5delta32, CCR2-64I and SDF1-3'A and plasma levels of SDF-1 in HIV-1 seronegative North Indians.
17216598 2007 CCR2 expression correlates with prostate cancer progression.
17135764 2007 Genotypes and haplotypes of CCR2 and CCR3 genes in Japanese cedar pollinosis.
17094383 Genetic polymorphism of chemokine receptors CCR2 and CCR5 in Swedish cervical cancer patients.
17091019 2007 Effect of genetic variants of CCR2 and CCL2 on the natural history of HIV-1 infection: CCL2-2518GG is overrepresented in a cohort of Spanish HIV-1-infected subjects.
17060059 2006 Blood pressure regulation by CCR genes.
16950632 2006 Chemokine gene polymorphisms in idiopathic anterior uveitis.
16908772 2006 Oxidized lipid-driven chemokine receptor switch, CCR2 to CX3CR1, mediates adhesion of human macrophages to coronary artery smooth muscle cells through a peroxisome proliferator-activated receptor gamma-dependent pathway.
16903979 2006 Influence of a monocyte chemoattractant protein 1 mutated allele on the response to protease inhibitor-based antiretroviral therapy.
16865553 2006 Gene polymorphisms in CCR5, CCR2, CX3CR1, SDF-1 and RANTES in exposed but uninfected partners of HIV-1 infected individuals in North India.
16858645 2005 Relationship of five inflammatory gene polymorphisms with morbidity and mortality in 533 patients admitted to an ICU.
16781696 2006 The expression of monocyte chemoattractant protein-1 and C-C chemokine receptor 2 in post-kidney transplant patients and the influence of simvastatin treatment.
16733654 2006 Chemokine expression by astrocytes plays a role in microglia/macrophage activation and subsequent neurodegeneration in secondary progressive multiple sclerosis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16631114 2006 Increased expression levels of monocyte CCR2 and monocyte chemoattractant protein-1 in patients with diabetes mellitus.
16621978 2006 The multiple personalities of the chemokine receptor CCR7 in dendritic cells.
16598837 Analysis of CC chemokine receptor 5 and 2 polymorphisms and renal transplant survival.
16529059 2005 [Effects of CCR5-delta32, CCR2-64I and SDF-1-3'A polymorphic alleles on human immunodeficiency virus 1 (HIV-1) infection in the Polish population].
16524739 2006 Polymorphisms in chemokine and chemokine receptor genes and the development of coal workers' pneumoconiosis.
16485782 2005 CCR5delta32, CCR2-64I, and SDF1-3'A polymorphisms related to resistance to HIV-1 infection and disease in the Ecuadorian population.
16480760 2007 Effects of polymorphisms in chemokine ligands and receptors on susceptibility to coronary artery disease.
16478397 2006 Analysis of CCR5, CCR2, CX3CR1, and SDF1 polymorphisms in HIV-positive treated patients: impact on response to HAART and on peripheral T lymphocyte counts.
16461193 2006 Genetic variations in CC chemokine receptors and hypertension.
16426243 2006 CCR2 allele polymorphisms in 15 Chinese ethnic populations.
16415174 2006 MCP-1/CCR2-dependent loop for fibrogenesis in human peripheral CD14-positive monocytes.
16356504 2006 Examination of genetic effects of polymorphisms in the MCP-1 and CCR2 genes on MI in the Icelandic population.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16323127 2006 Behavioral risk exposure and host genetics of susceptibility to HIV-1 infection.
16320328 2005 Chemokine receptor CCR2 expression by systemic sclerosis fibroblasts: evidence for autocrine regulation of myofibroblast differentiation.
16314800 2005 CCR5, RANTES and CX3CR1 polymorphisms: possible genetic links with acute heart rejection.
16305685 2005 Polymorphisms of chemokine receptors and eNOS in Brazilian patients with sickle cell disease.
16286055 2005 Distribution of HIV/AIDS protective SDF1, CCR5 and CCR2 gene variants within Cretan population.
16286054 2005 CCR2-64I and CXCL12 3'A alleles confer a favorable prognosis to AIDS patients undergoing HAART therapy.
16261210 2005 [Effect of CCR5delta32, CCR5m303, CCR2-64I and SDF1-3'A gene polymorphism on the prognosis of Chinese HIV-1 carriers].
16207551 2005 Additive effects of the chemokine receptor 2, vitamin D receptor, interleukin-6 polymorphisms and cardiovascular risk factors on the prevalence of myocardial infarction in patients below 65 years.
16206074 2005 Stromal cell-derived factor-1 genotype, coreceptor tropism, and HIV type 1 disease progression.
16196460 2005 Lack of association of CCR gene polymorphisms and left ventricular hypertrophy in essential hypertension.
16140745 2005 Combined effect of CCR5-Delta32 heterozygosity and the CCR5 promoter polymorphism -2459 A/G on CCR5 expression and resistance to human immunodeficiency virus type 1 transmission.
16123688 2005 Distribution of CCR2-64I and SDF1-3'A alleles and HIV status in 7 ethnic populations of Cameroon.
16095529 2005 A role for MCP-1/CCR2 in interstitial lung disease in children.
16055130 2006 Polymorphisms in the CC-chemokine receptor-2 (CCR2) and -5 (CCR5) genes and risk of coronary heart disease among US women.
16033640 2005 CCR2 and CXCR3 agonistic chemokines are differently expressed and regulated in human alveolar epithelial cells type II.
15995708 2005 Pivotal function for cytoplasmic protein FROUNT in CCR2-mediated monocyte chemotaxis.
15980693 2005 Causal pathways of the effects of age and the CCR5-Delta32, CCR2-64I, and SDF-1 3'A alleles on AIDS development.
15976001 2005 Coagulation cascade activation causes CC chemokine receptor-2 gene expression and mononuclear cell activation in hemodialysis patients.
15929697 2005 Effect of CCR2 chemokine receptor polymorphism on HIV type 1 mother-to-child transmission and child survival in Western Kenya.
15863470 2005 The CCR5-delta32 mutation: impact on disease outcome in individuals with hepatitis C infection from a single source.
15793370 2005 The effect of RANTES chemokine genetic variants on early HIV-1 plasma RNA among African American injection drug users.
15769362 2004 [Genetic polymorphism of human immunodeficiency virus coreceptor CCR5Delta32 and CCR2-64I alleles in Chinese Yi Ethnic group in Sichuan].
15754978 2004 Distribution of CCR5-delta32, CCR2-64I, and SDF1-3'A mutations in populations from the Brazilian Amazon region.
15750046 2005 Study of C-C chemokine receptor 2 alleles in sarcoidosis, with emphasis on family-based analysis.
15721423 2005 Protective role of the polymorphism CCR2-64I in the progression from squamous intraepithelial lesions to invasive cervical carcinoma.
15639953 2003 [Distribution of the HIV/AIDS associated CCR5Delta32,CCR2b-64I,SDF1-3'A allelesin Chinese Dai and Chingpaw populations from Dehong autonomous prefecture of Yunnan Province].
15611878 2005 The correlation between monocyte chemoattractant protein-1 and the arthritis of systemic lupus erythematosus among Chinese.
15602133 2004 Dominant effects of CCR2-CCR5 haplotypes in HIV-1 disease progression.
15585333 2005 The frequency of CCR5Delta32 and CCR2-64I in southern Iranian normal population.
15579296 2004 CCR2 polymorphisms affect neuropsychological impairment in HIV-1-infected adults.
15575507 2004 [Distribution of the HIV-1 resistance-conferring alleles (CCR5delta32, CCR2-64I, and SDF1 3'A) in Russian, Ukrainian, and Belarusian populations].
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15488313 2004 Chemokines (RANTES and MCP-1) and chemokine-receptors (CCR2 and CCR5) gene polymorphisms in Alzheimer's and Parkinson's disease.
15472820 2004 CCR2 genotype and disease progression in a treated population of HIV type 1-infected women.
15466648 2004 Atherosclerosis in patients infected with HIV is influenced by a mutant monocyte chemoattractant protein-1 allele.
15465089 2004 CCR2-64I polymorphism and CCR5Delta32 deletion in patients with Alzheimer's disease.
15458467 2004 Donor genomics influence graft events: the effect of donor polymorphisms on acute rejection and chronic allograft nephropathy.
15362666 2004 CCR5 promoter human haplogroups associated with HIV-1 disease progression in Thai injection drug users.
15319853 2004 Analysis of genetic polymorphisms in CCR5, CCR2, stromal cell-derived factor-1, RANTES, and dendritic cell-specific intercellular adhesion molecule-3-grabbing nonintegrin in seronegative individuals repeatedly exposed to HIV-1.
15257681 2004 Chemokine CCL2 and chemokine receptor CCR2 in early active multiple sclerosis.
15236615 2004 Association of highly active antiretroviral therapy failure with chemokine receptor 5 wild type.
15230854 2004 Analysis of CCR5-Delta 32 and CCR2-V64I polymorphisms in a cohort of Spanish HCV patients using real-time polymerase chain reaction and fluorescence resonance energy transfer technologies.
15192276 2004 CCR5 promoter polymorphism influences the interferon response of patients with chronic hepatitis C in Japan.
15140377 2004 Prevalence of alleles associated with HIV resistance in Russia.
15135805 2004 Polymorphisms of chemokine and chemokine receptor genes in Type 1 diabetes mellitus and its complications.
15086398 2004 Genetic variants in the CCR gene cluster and spontaneous viral elimination in hepatitis C-infected patients.
15086346 2004 Lack of association of human chemokine receptor gene polymorphisms CCR2-64I and CCR5-Delta32 with autoimmune Addison's disease.
15076247 2004 Prevalence of chemokine and chemokine receptor polymorphisms in seroprevalent children with symptomatic HIV-1 infection in the United States.
14981141 2004 Analysis of the involvement of CCR5-Delta32 and CCR2-V64I variants in the development of endometriosis.
14742283 2004 Fraction of cases of acquired immunodeficiency syndrome prevented by the interactions of identified restriction gene variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647058 2003 Association of genetic variants of the chemokine receptor CCR5 and its ligands, RANTES and MCP-2, with outcome of HCV infection.
14644039 2003 C-C chemokine receptor 2 gene polymorphism in Japanese patients with multiple sclerosis.
14624371 2003 Genetic influence of CCR5, CCR2, and SDF1 variants on human immunodeficiency virus 1 (HIV-1)-related disease progression and neurological impairment, in children with symptomatic HIV-1 infection.
14533983 2003 Frequency of polymorphisms of genes coding for HIV-1 co-receptors CCR5 and CCR2 in a Brazilian population.
14533004 2003 Genotypes of CCR2 and CCR5 chemokine receptors in human myasthenia gravis.
13678532 2003 Induction of heme oxygenase-1 in monocytes suppresses angiotensin II-elicited chemotactic activity through inhibition of CCR2: role of bilirubin and carbon monoxide generated by the enzyme.
12913933 2003 Chemokine receptor CCR2/CCR5 polymorphism in Spanish patients with systemic lupus erythematosus.
12889997 2003 Association between polymorphisms in the human chemokine receptor genes CCR2 and CX3CR1 and rheumatoid arthritis.
12884524 2003 Determination of the CCR2-64I/CCR5-59653T haplotype linkage disequilibrium in a sample of Polish population.
12882757 2003 C-C chemokine receptor 2 and sarcoidosis: association with Lofgren's syndrome.
12853745 2003 Effects of CCR5-delta32 and CCR2-64I alleles on disease progression of perinatally HIV-1-infected children: an international meta-analysis.
12853162 2003 CC chemokine receptor (CCR)2 polymorphism in Czech patients with myocardial infarction.
12837756 2003 Constitutive activation of CCR5 and CCR2 induced by conformational changes in the conserved TXP motif in transmembrane helix 2.
12719858 2003 Chemokine receptor (CCR2) genotype is associated with myocardial infarction and heart failure in patients under 65 years of age.
12680626 2003 CCR5 and CCR2 gene polymorphisms in hypertensive patients.
12654703 2003 Prediction of genetic risk for hypertension.
12651900 2003 Hormonal and embryonic regulation of chemokine receptors CXCR1, CXCR4, CCR5 and CCR2B in the human endometrium and the human blastocyst.
12584049 2003 Chemokine receptor genotype and response to interleukin-2 therapy in HIV-1-infected individuals.
12571520 2003 Population survey of CCR5 delta32, CCR5 m303, CCR2b 64I, and SDF1 3'A allele frequencies in indigenous Chinese healthy individuals, and in HIV-1-infected and HIV-1-uninfected individuals in HIV-1 risk groups.
12557141 2003 Associations of chemokine system polymorphisms with clinical outcomes and treatment responses of chronic hepatitis C.
12556692 2003 Effects of CCR5-Delta32 and CCR2-64I alleles on HIV-1 disease progression: the protection varies with duration of infection.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12469616 Association of the CCR2 chemokine receptor gene polymorphism with myocardial infarction.
12447757 2002 CC chemokine receptor 5 delta32 and CC chemokine receptor 2 64I polymorphisms do not influence the virologic and immunologic response to antiretroviral combination therapy in human immunodeficiency virus type 1-infected patients.
12445801 2002 The presence of chemokine (MCP-1, MIP-1alpha, MIP-1beta, IP-10, RANTES)-positive cells and chemokine receptor (CCR5, CXCR3)-positive cells in inflamed human gingival tissues.
12436194 2002 Distribution of two HIV-1-resistant polymorphisms (SDF1-3'A and CCR2-64I alleles) in the Polish population.
12426226 2002 Val64Ile polymorphism in the C-C chemokine receptor 2 is associated with reduced coronary artery calcification.
12403355 2002 C-C chemokine receptor 2 and C-C chemokine receptor 5 genotypes in patients treated for chronic hepatitis C virus infection.
12399623 2002 Differential expression of MCP-1 and its receptor CCR2 in glucose primed human mesangial cells.
12374865 2002 HIV-1 infection and AIDS dementia are influenced by a mutant MCP-1 allele linked to increased monocyte infiltration of tissues and MCP-1 levels.
12271471 2002 Functional expression of CCR2 by human fetal astrocytes.
12239249 2002 A Monocyte chemoattractant protein-1 (MCP-1) polymorphism and outcome after renal transplantation.
12215924 2002 [Do polymorphisms of the SDF1 and CCR2b genes modify the course of hepatitis C or HIV/HCV co-infection?].
12201365 2002 The impact of polymorphisms in chemokine and chemokine receptors on outcomes in liver transplantation.
12192431 2002 Structural analysis of human CCR2b and primate CCR2b by molecular modeling and molecular dynamics simulation.
12149192 2002 Matrix metalloproteinase processing of monocyte chemoattractant proteins generates CC chemokine receptor antagonists with anti-inflammatory properties in vivo.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12079277 2002 Association of a polymorphism of the CC chemokine receptor-2 gene with bone mineral density.
12078856 2002 Induction of MCP-1 expression in airway epithelial cells: role of CCR2 receptor in airway epithelial injury.
12070001 2002 Trafficking machinery of NKT cells: shared and differential chemokine receptor expression among V alpha 24(+)V beta 11(+) NKT cell subsets with distinct cytokine-producing capacity.
12032878 Prevalence of HIV co-receptor polymorphisms in HIV-infected patients and uninfected volunteers in Luxembourg.
12010355 2002 Heterozygosity for CCR5-Delta32 but not CCR2b-64I protects against certain intracellular pathogens.
12001056 2002 Chemokine receptor gene polymorphisms and risk of human T lymphotropic virus type I infection in Jamaica.
11988632 2001 Distribution of HIV-1 resistance-conferring polymorphic alleles SDF-1-3'A, CCR2-64I and CCR5-Delta32 in diverse populations of Andhra Pradesh, South India.
11964548 2002 Chemokine receptor polymorphisms and GB virus C status in HIV-positive patients.
11958683 2002 CCR2 and CCR5 genotypes in HIV type 1-infected adolescents: limited contributions to variability in plasma HIV type 1 RNA concentration in the absence of antiretroviral therapy.
11898620 2002 [Frequencies of the CCR2-64I and SDF1-3'A alleles associated with progression of the HIV-1 disease in healthy individuals from Moscow].
11873083 2002 Genetic analysis of HIV-1 discordant couples in Thailand: association of CCR2 64I homozygosity with HIV-1-negative status.
11860823 2000 [Polymorphisms of chemokine receptor alleles influencing genetic susceptibility to HIV-1 infection in Mongolia population in China].
11860793 2000 [Distribution of HIV resistance CCR5-delta 32, CCR2-64 I and SDF1-3'A alleles and their polymorphisms in the Han population in China].
11856781 2002 Chemokine receptor polymorphism and risk of acute rejection in human renal transplantation.
11782014 2002 Sequential involvement of CCR2 and CCR6 ligands for immature dendritic cell recruitment: possible role at inflamed epithelial surfaces.
11779135 2002 Differential expression of the isoforms for the monocyte chemoattractant protein-1 receptor, CCR2, in monocytes.
11756347 2002 Chemokine receptor genotype is associated with diabetic nephropathy in Japanese with type 2 diabetes.
11752157 2002 Distribution of chemokine receptor CCR2 and CCR5 genotypes and their relative contribution to human immunodeficiency virus type 1 (HIV-1) seroconversion, early HIV-1 RNA concentration in plasma, and later disease progression.
11729511 2001 Genotypes and polymorphisms of mutant CCR5-delta 32, CCR2-64I and SDF1-3' a HIV-1 resistance alleles in indigenous Han Chinese.
11709782 2001 Associations of CCR5, CCR2, and stromal cell-derived factor 1 genotypes with human immunodeficiency virus disease progression in patients receiving nucleoside therapy.
11696224 2001 Distribution of CCR5-Delta 32 and CCR2-64I alleles in an Argentine Amerindian population.
11694103 2001 Effects of CCR5-Delta32, CCR2-64I, and SDF-1 3'A alleles on HIV-1 disease progression: An international meta-analysis of individual-patient data.
11596075 2001 Adverse effect of the CCR5 promoter -2459A allele on HIV-1 disease progression.
11590385 2001 Functional expression of chemokine receptor 2 by normal human eosinophils.
11500196 2001 Involvement of polymorphisms in the chemokine system in the susceptibility for coronary artery disease (CAD). Coincidence of elevated Lp(a) and MCP-1 -2518 G/G genotype in CAD patients.
11485615 2001 Polymorphism of CCR5 affecting HIV disease progression in the Japanese population.
11477473 2001 Genetic variation at the chemokine receptors CCR5/CCR2 in myocardial infarction.
11470772 2001 Human CC chemokine liver-expressed chemokine/CCL16 is a functional ligand for CCR1, CCR2 and CCR5, and constitutively expressed by hepatocytes.
11468722 2001 Lack of effect of chemokine receptor CCR2b gene polymorphism (64I) on HIV-1 plasma RNA viral load and immune activation among HIV-1 seropositive female workers in Abidjan, Côte d'Ivoire.
11385319 2001 A multiethnic study of Delta32ccr5 and ccr2b-V64I allele distribution in four Los Angeles populations.
11377705 2001 Polymorphism of CC chemokine receptors CCR2 and CCR5 in Crohn's disease.
11350939 2001 Chemokine receptor homo- or heterodimerization activates distinct signaling pathways.
11264152 2001 Eotaxin is a natural antagonist for CCR2 and an agonist for CCR5.
11181995 2001 The sequence of the human genome.
11175286 2000 Distribution of three HIV-1 resistance-conferring polymorphisms (SDF1-3'A, CCR2-641, and CCR5-delta32) in global populations.
11120855 2000 Basophil responses to chemokines are regulated by both sequential and cooperative receptor signaling.
11046064 2000 Monocyte chemotactic protein-1 receptor CCR2B is a glycoprotein that has tyrosine sulfation in a conserved extracellular N-terminal region.
11023492 2000 CCR2-64I polymorphism, syncytium-inducing human immunodeficiency virus strains, and disease progression.
10985245 2000 The level of HIV infection of macrophages is determined by interaction of viral and host cell genotypes.
10888629 2000 Use of inhibitors to evaluate coreceptor usage by simian and simian/human immunodeficiency viruses and human immunodeficiency virus type 2 in primary cells.
10751368 2000 Chemokine and chemokine-receptor expression in human glial elements: induction by the HIV protein, Tat, and chemokine autoregulation.
10741397 2000 Human intestinal lamina propria and intraepithelial lymphocytes express receptors specific for chemokines induced by inflammation.
10623817 2000 Defective expression of the monocyte chemotactic protein-1 receptor CCR2 in macrophages associated with human ovarian carcinoma.
10529171 1999 Identification of residues in the monocyte chemotactic protein-1 that contact the MCP-1 receptor, CCR2.
10479649 1999 Expression of CCR2 by endothelial cells : implications for MCP-1 mediated wound injury repair and In vivo inflammatory activation of endothelium.
10201901 1999 Chemokine receptor responses on T cells are achieved through regulation of both receptor expression and signaling.
9886417 1999 Characterization of the signal transduction pathway activated in human monocytes and dendritic cells by MPIF-1, a specific ligand for CC chemokine receptor 1.
9789057 1998 HIV-1 Tat protein mimicry of chemokines.
9710230 1998 Tumor-driven matrix invasion by infiltrating lymphocytes: involvement of the alpha1 integrin I-domain.
9670957 1998 The chemokine monocyte chemotactic protein 1 triggers Janus kinase 2 activation and tyrosine phosphorylation of the CCR2B receptor.
9662369 1998 Genealogy of the CCR5 locus and chemokine system gene variants associated with altered rates of HIV-1 disease progression.
9548499 1997 Characterization of the CCR2 chemokine receptor: functional CCR2 receptor expression in B cells.
9501202 1998 Monocyte chemoattractant protein-1-induced CCR2B receptor desensitization mediated by the G protein-coupled receptor kinase 2.
9287323 1997 The amino-terminal domain of CCR2 is both necessary and sufficient for high affinity binding of monocyte chemoattractant protein 1. Receptor activation by a pseudo-tethered ligand.
9252328 1997 Contrasting genetic influence of CCR2 and CCR5 variants on HIV-1 infection and disease progression. Hemophilia Growth and Development Study (HGDS), Multicenter AIDS Cohort Study (MACS), Multicenter Hemophilia Cohort Study (MHCS), San Francisco City Cohort (SFCC), ALIVE Study.
9225989 1997 MCP-1 and CCR2 in HIV infection: regulation of agonist and receptor expression.
9195948 1997 Cloning, in vitro expression, and functional characterization of a novel human CC chemokine of the monocyte chemotactic protein (MCP) family (MCP-4) that binds and signals through the CC chemokine receptor 2B.
9143512 1997 The beta-chemokine receptor genes CCR1 (CMKBR1), CCR2 (CMKBR2), and CCR3 (CMKBR3) cluster within 285 kb on human chromosome 3p21.
9115216 1997 Monocyte chemotactic protein-2 (MCP-2) uses CCR1 and CCR2B as its functional receptors.
9058802 1997 IL-2-regulated expression of the monocyte chemotactic protein-1 receptor (CCR2) in human NK cells: characterization of a predominant 3.4-kilobase transcript containing CCR2B and CCR2A sequences.
8995400 1997 Organization and differential expression of the human monocyte chemoattractant protein 1 receptor gene. Evidence for the role of the carboxyl-terminal tail in receptor trafficking.
8884276 1996 The genes encoding the human CC-chemokine receptors CC-CKR1 to CC-CKR5 (CMKBR1-CMKBR5) are clustered in the p21.3-p24 region of chromosome 3.
8530354 1995 Monocyte chemoattractant protein-3 is a functional ligand for CC chemokine receptors 1 and 2B.
8146186 1994 Molecular cloning and functional expression of two monocyte chemoattractant protein 1 receptors reveals alternative splicing of the carboxyl-terminal tails.
8048929 1994 cDNA cloning and functional expression of a human monocyte chemoattractant protein 1 receptor.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.