Property Summary

NCBI Gene PubMed Count 420
PubMed Score 1034.31
PubTator Score 668.36

Knowledge Summary

Patent (131,367)

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
lung carcinoma 2844 2.6816994596996E-15
ovarian cancer 8492 1.97318230960057E-7
psoriasis 6685 1.8708144566458E-6
hepatocellular carcinoma 550 4.16050608807105E-6
primary Sjogren syndrome 789 2.81191365567369E-5
ulcerative colitis 2087 3.55679693081929E-5
osteosarcoma 7933 4.43473845406151E-5
lung cancer 4473 6.67842366530495E-5
adult high grade glioma 2148 1.69124110386524E-4
pancreatic cancer 2300 2.7167498499481E-4
pancreatic carcinoma 567 2.71674984994811E-4
tuberculosis 1563 5.08275429664741E-4
gastric cancer 436 0.00140333829123835
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00275713255977325
interstitial cystitis 2299 0.00280052074119211
glioblastoma 5572 0.00496381952982511
head and neck cancer and chronic obstructive pulmonary disease 237 0.00667353205649152
cutaneous lupus erythematosus 1056 0.0111202239194966
sarcoidosis 368 0.0189694416800359
head and neck cancer 270 0.0219468730000951
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0228780365704961
chronic kidney disease 90 0.0356099858680912
Waldenstrons macroglobulinemia 765 0.0445293329958553
Disease Target Count Z-score Confidence
Celiac disease 112 0.0 2.0

Expression

  Differential Expression (23)

Synonym

Accession P41597 A0AVQ3 B2RMT0 Q4VBL2 C-C CKR-2
Symbols CKR2
CCR-2
CCR2A
CCR2B
CD192
CKR2A
CKR2B
CMKBR2
MCP-1-R
CC-CKR-2

Gene

PDB

1KAD   1KP1  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid

  TechDev Info (1)

 OMIM Term (1)

Gene RIF (438)

PMID Text
27534043 CCR2 gene polymorphism (64I allele carriage) is a predisposing factor for allergy.
27239844 The frequencies of the rare alleles of CCR2, ITGB3, and 3'UTR of c-fms in the Old Believers are lower than in the sample of Novosibirsk Russians, and the rare allele of DBH is more frequent
26982176 data suggest that the CCR2-64I polymorphism is associated with the protective effect to development of cervical lesions as well as in the protection to HPV 16 infection.
26648448 These findings suggested that the CCL2/CCR2 chemokine signaling may regulate the epithelial-mesenchymal transition.
26300579 Among HIV-seropositive samples 3.4% were homozygous CCR2-64I mutants, 17.8%) were heterozygous,78.8% were CCR2 wild type.
26211665 Ovarian cancer cells express both Hp and its receptor CCR2 but only after exposure to ascitic fluid, inducing moderated cell migration; results suggest that Hp-induced changes in the cell morphology, actin cytoskeleton structure, and migration ability of tumor cells, is possibly "preparing" these cells for the potential induction of the metastatic phenotype.
26123579 Association of hydrogen sulfide with alterations of monocyte chemokine receptors, CCR2 and CX3CR1 in patients with coronary artery disease
25966143 A polymorphism in MCP-1 may be correlated with the development of non-small cell clung cancer (NSCLC) in the Han nationality of Northern China. However, the polymorphism in CCR-2 is not involved in NSCLC.
25808810 results suggest that senescent dermal fibroblasts recruit stem cells by secreting various factors and that the CCL2/CCR2 axis is one of the mechanisms underlying this phenomenon
25797207 Single nucleotide polymorphism is associated with Non-Small Cell Lung Cancer in Tunisian patients
More...

AA Sequence

MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINC      1 - 70
KKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYL     71 - 140
AIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILG    141 - 210
LVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCEST    211 - 280
SQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL    281 - 350
LDGRGKGKSIGRAPEASLQDKEGA                                                  351 - 374
//

Text Mined References (421)

PMID Year Title
27534043 2010 [STUDY OF CHEMOKINE RECEPTOR CCR2 GENE POLYMORPHISM IN PATIENTS WITH ASTHMA AND THEIR RELATIVES].
27239844 [Gene Polymorphism of the c-fms, ITGB3,CCR2, and DBH genes in the populations of old believers of the Tyumen oblast and Russian residents of Novosibirsk].
26982176 2016 CCR2 and CCR5 genes polymorphisms in women with cervical lesions from Pernambuco, Northeast Region of Brazil: a case-control study.
26648448 2016 N-methyl-N-nitro-N'-nitrosoguanidine induces the expression of CCR2 in human gastric epithelial cells promoting CCL2-mediated migration.
26300579 2015 Chemokine Coreceptor-2 Gene Polymorphisms among HIV-1 Infected Individuals in Kenya.
26211665 2015 Haptoglobin and CCR2 receptor expression in ovarian cancer cells that were exposed to ascitic fluid: exploring a new role of haptoglobin in the tumoral microenvironment.
26123579 2015 Association of hydrogen sulfide with alterations of monocyte chemokine receptors, CCR2 and CX3CR1 in patients with coronary artery disease.
25966143 2015 Relationship between genetic polymorphisms in MCP-1, CCR-2, and non-small-cell lung cancer in the Han nationality of Northern China.
25808810 2015 Senescent dermal fibroblasts enhance stem cell migration through CCL2/CCR2 axis.
25797207 2015 CCR2-64I polymorphism is associated with Non-Small Cell Lung Cancer in Tunisian patients.
More...