Property Summary

Ligand Count 301
NCBI Gene PubMed Count 128
PubMed Score 321.89
PubTator Score 269.11

Knowledge Summary

Patent (46,869)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Behcet's syndrome 50
Contact Dermatitis 81

Expression

Protein-protein Interaction (11)

Gene RIF (89)

AA Sequence

METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLVQYKRLKNMTS      1 - 70
IYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSEIFFIILLTIDRYLAIVHAVF     71 - 140
ALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTHHTCSLHFPHESLREWKLFQALKLNLFGLVL    141 - 210
PLLVMIICYTGIIKILLRRPNEKKSKAVRLIFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLD    211 - 280
LAVQVTEVIAYTHCCVNPVIYAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHE    281 - 350
LSAGF                                                                     351 - 355
//

Text Mined References (128)

PMID Year Title