Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.07
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.7e-11
ovarian cancer 8520 1.0e-06
cystic fibrosis 1696 2.9e-04
Breast cancer 3578 2.1e-03
diabetes mellitus 1728 2.6e-03
osteosarcoma 7950 6.8e-03
group 4 medulloblastoma 1855 2.0e-02
spina bifida 1074 3.4e-02

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer 1.100 2.1e-03
cystic fibrosis -1.079 2.9e-04
diabetes mellitus -1.200 2.6e-03
group 4 medulloblastoma -1.300 2.0e-02
osteosarcoma -1.360 6.8e-03
ovarian cancer -2.100 1.0e-06
psoriasis 1.100 3.7e-11
spina bifida -1.513 3.4e-02

AA Sequence

MGNTLTCCVSPNASPKLGRRAGSAELYCASDIYEAVSGDAVAVAPAVVEPAELDFGEGEGHHLQHISDRE      1 - 70
MPEDLALESNPSDHPRASTIFLSKSQTDVREKRKSNHLNHVSPGQLTKKYSSCSTIFLDDSTVSQPNLRT     71 - 140
TVKCVTLAIYYHIKNRDANRSLDIFDERSHPLTREKVPEEYFKHDPEHKFIYRFVRTLFSAAQLTAECAI    141 - 210
VTLVYLERLLTYAEIDICPTNWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELL    211 - 280
QFNINVPASVYAKYYFDLRSLADDNNLNFLFAPLSKERAQNLEAISRLCEDKDLCRAAMRRSFSADNFIG    281 - 350
IQRSKAILS                                                                 351 - 359
//

Text Mined References (20)

PMID Year Title