Property Summary

NCBI Gene PubMed Count 33
PubMed Score 27.83
PubTator Score 18.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 2.000 4.7e-05
astrocytic glioma -1.300 1.5e-02
ependymoma -1.200 1.9e-02
glioblastoma multiforme -1.600 1.2e-31
oligodendroglioma -1.100 2.8e-14
osteosarcoma -1.677 5.3e-06
cystic fibrosis 1.063 8.7e-04
atypical teratoid / rhabdoid tumor -1.600 1.5e-05
medulloblastoma -1.500 5.5e-06
medulloblastoma, large-cell -1.600 3.5e-04
primitive neuroectodermal tumor -1.100 1.5e-03
pancreatic ductal adenocarcinoma liver m... -1.302 7.9e-03
tuberculosis 1.200 3.0e-07
adult high grade glioma -1.400 1.7e-02
ovarian cancer 3.000 5.0e-07

Gene RIF (17)

PMID Text
26205494 Activation of PCTAIRE-1 is mediated through interaction with the phosphorylated form of cyclin Y in complex with 14-3-3.
24824184 Our findings highlight a PFTK1-CCNY complex in activating noncanonical Wnt signaling in HCC cells.
24794231 Human cyclin Y (CCNY) is a phosphoprotein in vivo and phosphorylation of CCNY by CDK14 triggers its ubiquitination and degradation.
22895054 Cyclin Y regulates the expression and membrane trafficing of PCTAIRE kinases (PCTK). (Review)
22184064 CCNY binding to CDK16 required a region upstream of the kinase domain and was found to be inhibited by phosphorylation of serine 153, a potential PKA phosphorylation site.
21273179 these results validated the role of CCNY as a clinically relevant human oncoprotein
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20441050 CCNY might play an important role in glioma tumorigenisis.
20176734 Observational study of gene-disease association. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19204726 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
19068216 Observational study of gene-disease association. (HuGE Navigator)
18984674 Observational study of gene-disease association. (HuGE Navigator)
18438405 Single nucleotide polymorphism in CCNY gene is associated with Crohn's disease and ulcerative colitis
18438405 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL      1 - 70
SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM     71 - 140
LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA    141 - 210
NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS    211 - 280
LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS             281 - 341
//

Text Mined References (42)

PMID Year Title
26205494 2015 Cyclin Y phosphorylation- and 14-3-3-binding-dependent activation of PCTAIRE-1/CDK16.
24824184 2014 PFTK1 interacts with cyclin Y to activate non-canonical Wnt signaling in hepatocellular carcinoma.
24794231 2014 Phosphorylation of cyclin Y by CDK14 induces its ubiquitination and degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895054 2012 Orphan kinases turn eccentric: a new class of cyclin Y-activated, membrane-targeted CDKs.
22184064 2012 Cyclin-dependent kinase 16/PCTAIRE kinase 1 is activated by cyclin Y and is essential for spermatogenesis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21273179 2011 Cell cycle protein cyclin Y is associated with human non-small-cell lung cancer proliferation and tumorigenesis.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20886065 2010 Molecular reclassification of Crohn's disease by cluster analysis of genetic variants.
20441050 2010 Lentivirus-mediated knockdown of cyclin Y (CCNY) inhibits glioma cell proliferation.
20176734 2010 Comparative genetic analysis of inflammatory bowel disease and type 1 diabetes implicates multiple loci with opposite effects.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20059949 2009 Cell cycle control of wnt receptor activation.
19524571 2009 Cyclin Y, a novel membrane-associated cyclin, interacts with PFTK1.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
19068216 2009 Investigation of Crohn's disease risk loci in ulcerative colitis further defines their molecular relationship.
18984674 2009 KIF5B gene sequence variation and response of cardiac stroke volume to regular exercise.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18438405 2008 Replication of signals from recent studies of Crohn's disease identifies previously unknown disease loci for ulcerative colitis.
18088087 2008 Phosphoproteome of resting human platelets.
18060517 2009 Identification and characterization of cyclin X which activates transcriptional activities of c-Myc.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.