Property Summary

NCBI Gene PubMed Count 36
PubMed Score 30.14
PubTator Score 18.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.400 1.7e-02
astrocytic glioma -1.300 1.5e-02
atypical teratoid / rhabdoid tumor -1.600 1.5e-05
cystic fibrosis 1.063 8.7e-04
ependymoma -1.200 1.9e-02
glioblastoma -1.500 2.4e-05
medulloblastoma -1.500 5.5e-06
medulloblastoma, large-cell -1.600 3.5e-04
oligodendroglioma -1.100 2.8e-14
osteosarcoma -1.677 5.3e-06
ovarian cancer 3.000 5.0e-07
pancreatic ductal adenocarcinoma liver m... -1.302 7.9e-03
primitive neuroectodermal tumor -1.100 1.5e-03
Rheumatoid arthritis 2.000 4.7e-05
tuberculosis 1.200 3.0e-07

Gene RIF (20)

AA Sequence

MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPRASTIFL      1 - 70
SKSQTDVREKRKSLFINHHPPGQIARKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRM     71 - 140
LLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPA    141 - 210
NWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYFDLRS    211 - 280
LAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRSARKRSASADNLTLPRWSPAIIS             281 - 341
//

Text Mined References (45)

PMID Year Title