Property Summary

Ligand Count 183
NCBI Gene PubMed Count 189
PubMed Score 152.29
PubTator Score 193.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 1.600 3.0e-02
acute quadriplegic myopathy 1.135 6.9e-06
juvenile dermatomyositis 1.168 5.0e-12
osteosarcoma 2.666 7.5e-08
ovarian cancer -1.700 2.7e-07
Pick disease 1.400 4.0e-06
primary pancreatic ductal adenocarcinoma 1.002 1.4e-02
psoriasis -1.200 5.6e-03

Protein-protein Interaction (1)

PDB (22)

Gene RIF (258)

AA Sequence

MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFY      1 - 70
MIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESII     71 - 140
LQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNW    141 - 210
EIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSE    211 - 280
QTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHR    281 - 350
TSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY    351 - 420
AAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAA    421 - 490
DKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYS    491 - 560
LSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSLNFSFPSLPTMGQMPGHSSDTSGLSFSQPSC    561 - 630
KTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISS    631 - 700
RSGNTDKPRPPPLPSEPPPPLPPLPK                                                701 - 726
//

Text Mined References (202)

PMID Year Title