Property Summary

NCBI Gene PubMed Count 183
PubMed Score 148.07
PubTator Score 193.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 5.6e-03
osteosarcoma 2.666 7.5e-08
juvenile dermatomyositis 1.168 5.0e-12
acute quadriplegic myopathy 1.135 6.9e-06
primary pancreatic ductal adenocarcinoma 1.002 1.4e-02
Pick disease 1.400 4.0e-06
acute myeloid leukemia 1.600 3.0e-02
ovarian cancer -1.700 2.7e-07

Gene RIF (252)

PMID Text
25909811 the introduction of HIV-1 Tat and Mg12+ ion resulted in the active site architectural characteristics of phosphorylated CDK9/cyclin T1 complex
25781978 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25735922 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25731772 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25653431 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25496916 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
25132562 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24985467 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24985203 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24793763 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24727379 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24565118 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24515107 the release of P-TEFb from the 7SK snRNP led to increased synthesis of HEXIM1 but not HEXIM2
24367103 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24359561 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24351800 The sequence domain of human cytomegalovirus pUL97 responsible for the interaction with cyclin T1 was between amino acids 231-280.
24316072 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24217245 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24204263 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
24158816 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23977272 Plk1 negatively regulates the RNA polymerase II-dependent transcription through inhibiting the activity of cyclin T1/Cdk9 complex.
23827503 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23754689 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23691059 All of the hCD4/R5/cT1 mice developed disseminated infection of tissues that included the spleen, small intestine, lymph nodes and lungs after intravenous injection with an HIV-1 infectious molecular clone
23678366 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23658523 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23569210 CYCT1b is a newly identified cyclin T1 splice variant whose expression leads to direct inhibition of TAT-transactivated transcription of the HIV-1 LTR promoter
23569210 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23539624 positive transcription elongation factor b (P-TEFb, made of CDK9 and CycT1) is released from its inhibitory complex by histone deacetylase inhibitors, which also activate HIV transcription
23518577 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23471103 AFF4 is positioned to make unexpected direct contacts with HIV Tat, and Tat enhances P-TEFb/CCNT1 affinity for AFF4.
23330719 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23274668 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23247501 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23170164 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23152527 The authors find that resting CD4(+) T cells, whether naive or memory and independent of their HIV infection status, have low levels of Cyclin T1 and T-loop-phosphorylated CDK9, which increase upon activation.
23110726 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23092279 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23087374 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
23007159 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22959624 Structural determination of a short-lived conformational state between CCNT1 and CDK9 that is adopted during the phosphorylation cycle.
22692005 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22567366 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22422068 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22421880 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22355797 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22342181 N-terminal residues in cyclin T1 are specifically involved in the binding of cyclin T1 to HEXIM1 but not to Tat.
22342181 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22253435 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22229121 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22211660 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22205749 MiR-27b, miR-29b, miR-223, and miR-150 are regulators of cyclin T1 protein levels and HIV-1 replication in resting CD4+ T cells.
22190034 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
22100159 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
21951552 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
21763496 This investigation reveals a novel mechanism of cyclin T1 regulation and establishes NF90 as a regulator of HIV-1 replication during both productive infection and induction from latency.
21763494 The role of the CycT1 N-terminal region in Tat action, was investigated.
21763494 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
21709748 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
21555514 Cyclin K inhibits HIV-1 gene expression and replication by interfering with cyclin-dependent kinase 9 (CDK9)-cyclin T1 interaction in Nef-dependent manner.
21450947 HCMV inter-regulation with CDK9/cyclin T1 is at least partly based on a pUL69-cylin T1 interaction.
21360054 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
21204735 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
21035463 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20976203 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20943989 results suggest that cyclin T1/CDK9 serves as an adapter to mediate the interaction of influenza A virus RNA-dependent RNA polymerase and RNA Pol II and promote viral transcription
20828615 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20808803 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20724442 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20714219 Cyclin T1 oncogenic function and suggest a role for this protein in controlling cell cycle probably via Rb/E2F1 pathway.
20683478 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20618343 study showed that P-TEFb and Dengue virus (DENV) core protein work in concert to enhance IL-8 gene expression by DENV infection
20571604 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20562857 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20551309 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20535204 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20471949 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20471948 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20385240 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20385237 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20227660 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20210365 binding to Cyclin T1 induces an asymmetry or sterical hindrance in the first coiled coil segment of dimeric Hexim1 that disallows formation of a 2:2 complex.
20064163 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20054825 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
20018238 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19883659 The tripartite protein-RNA complex formation between Hexim, Cyclin T and 7SK snRNA, was analyzed.
19812265 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19716452 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19435492 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19387490 Cyclin T1 acetylation triggers dissociation of Hexim1 and 7SK snRNA from cyclin T1/CDK9 and activates the transcriptional activity of P-TEFb.
19387490 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19297489 binding of Brd4 to the cdk9 complex is not required but that efficient binding to cyclin T1 is essential
19275730 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19275586 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19223581 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19211771 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19179338 a direct impact of CDK9-cyclin T1 on the nuclear localization and activity of the viral regulator pUL69.
19139066 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
19020832 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
18991615 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
18976975 Knockdown of cyclin T1 (CCNT1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18976462 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
18931076 CycT1 may potentially serve as a target for the development of anti-HIV therapies by inactivating viral Tat protein.
18931076 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
18780834 functional and physical interaction of GATA-1 with components of the positive transcriptional elongation factor P-TEFb
18773076 Cyclin T1-dependent genes in activated CD4 T and macrophage cell lines appear enriched in HIV-1 co-factors
18655042 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
18620576 CycT1-U7 mutant inhibits HIV transcription by promoting a rapid degradation of Tat.
18620576 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
18566585 Study shows that CDK9/CycT1 autophosphorylates on Thr186 in the activation segment and three C-terminal phosphorylation sites; autophosphorylation on all sites occurs in cis.
18483487 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
18391197 TAF7 interacts with the transcription factors, TFIIH and P-TEFb, resulting in the inhibition of their Pol II CTD kinase activities
18353948 HIV infection increases the sensitivity of microglia and astrocytes to inflammatory stimulation and support the use of these mice as a model to investigate various aspects of the in vivo mechanism of HIV-induced neuronal dysfunction
18281698 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
18205180 This data suggests an active role for the Cdk9/Cyclin T1 complex during lymphoid differentiation through germinal center reaction.
18187620 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
18187620 Knockdown of cyclin T1 (CCNT1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18039861 while the P-TEFb level remains constant, the Brd4-P-TEFb interaction increases dramatically in cells progressing from late mitosis to early G(1).
17907378 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
17855633 Identification of ENL-associated proteins by mass spectrometry revealed enzymes with a known role in transcriptional elongation: pTEFb and DOT1L.
17724342 provide structural insights how Hexim1 recognizes the Cyclin T1 subunit of positive transcription elongation factor b
17690245 Overexpression of the BRD4 P-TEFb-interacting domain disrupts the interaction between the HIV transactivator Tat and P-TEFb and suppresses the ability of Tat to transactivate the HIV promoter
17686863 Tax may compete and functionally substitute for Brd4 in P-TEFb regulation.Tax and Brd4 compete for binding to P-TEFb through direct interaction with cyclin T1
17661632 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
17625008 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
17540406 Regions important for the interactions with partners as the TRM give insights into the spatial arrangment of critical residues that build up the interface for its regulatory factors.
17537237 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
17502349 Upon induction of NF-kappaB, a subset of target genes is regulated differentially by either P-TEFb or DSIF.[P-TEFb, DSIF]
17461970 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
17452463 These results suggest that acetylation of CDK9 is an important posttranslational modification that is involved in regulating P-TEFb transcriptional elongation function.
17352406 Cdk9/Cyclin T1 complex may be important in the activation/differentiation program of lymphoid cells and that its upregulation may contribute to malignant transformation.
17341462 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
17317667 WRN is a novel cellular cofactor for HIV-1 replication, and the WRN helicase participates in the recruitment of PCAF/P-TEFb-containing transcription complexes
17289077 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
17267505 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
17168834 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
17014716 Prostratin induces Cyclin T1 expression and P-TEFb function and this is likely to be involved in prostratin reactivation of latent HIV-1 proviruses
17014716 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
16980611 These data link the P-TEFb equilibrium to the intracellular transcriptional demand and proliferative/differentiated states of cells.
16838299 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
16781761 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
16764723 Using DNA microarray technology, we found that more than 20% of genes induced by PMA require cyclin T1 for their normal level of induction, and approximately 15% of genes repressed by PMA require cyclin T1 for their normal level of repression.
16764723 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
16615932 Finally, two inhibitors of cyclin-dependent kinase 9 (a dominant negative CDK9 and flavopiridol) repressed activity from the MR and BMPR2 promoters
16615932 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
16439541 human cyclin T1 expression is sufficient to support Tat-mediated transactivation in primary mouse CD4 T lymphocytes and monocytes/macrophages and increases in vitro and in vivo HIV-1 production by these stimulated cells.
16439541 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
16362050 the interplay between 7SK snRNA and oppositely charged regions in HEXIM1 direct its binding to P-TEFb and subcellular localization that culminates in the inhibition of transcription
16308568 Role of P-TEFb as an activator of transcription elongation can be separated from its role in RNA processing; neither function is universally required for expression of mammalian pol II-dependent genes.
16146763 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
16035254 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15994812 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15994294 analysis of positive transcription elongation factor - HEXIM1 - 7SK RNA complex
15940264 increased estrogen down regulated gene 1 expression results in inhibition of cyclin T1 recruitment and estrogen receptor 1 DNA binding
15913611 downregulation of hCycT1 did not cause apoptotic cell death
15905409 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15719065 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15713661 HEXIM1 and HEXIM2 maintain the balance between active and inactive forms of P-TEFb, a heterodimeric complex composed of cyclin-dependent kinase 9 and cyclin T.
15638724 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15563843 a histidine-rich stretch in CycT1 was found to direct the transcriptional activity of this P-TEFb complex when tethered artificially to DNA.
15498776 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15473004 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15183343 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15142377 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15139295 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
15107825 NUFIP and P-TEFb with BRCA1 activate transcription by RNA polymerase II
15049426 review of work indicating under some circumstances TAK/P-TEFb is likely to be limiting for HIV replication in CD4+ T cells and macrophages; review of mechanisms of regulation of the TAK/P-TEFb subunits in these cell types
14984439 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
14972556 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
14963154 RNAi-mediated gene silencing of P-TEFb in HeLa cells was not lethal and inhibited Tat transactivation and HIV-1 replication in host cells
14627702 major portion of nuclear P-TEFb is sequestered and inactivated by the coordinated actions of the 7SK snRNA
14569024 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
12944466 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
12887902 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
12832472 Since Tat also binds to this cyclin T1 domain and the association between 7SK RNA/MAQ1 and P-TEFb competes with the binding of Tat to cyclin T1, we speculate that the TAR RNA/Tat lentivirus system has evolved to subvert the cellular 7SK RNA/MAQ1 system
12832472 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
12753906 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
12727882 recruitment to nuclear bodies via direct interaction with PML protein
12727882 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
12651893 the transcriptional repressor PIE-1 from Caenorhabditis elegans binds Cyclin T1 via an alanine-containing heptapeptide repeat and inhibits transcriptional elongation {cyclin T1)
12588988 cyclin T1 binds with granulin to inhibit transcription
12588988 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
12486002 Cyclin T1 binding to HIV-1 tat is regulated by the differential acetylation of tat
12486002 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
12458222 Tat and trans-activation-responsive (TAR) RNA-independent induction of HIV-1 long terminal repeat by this protein requires Sp1
12368330 chimeras between kinase-inactive mutant Cdk9 and truncated cyclin T1 proteins efficiently inhibit Tat transactivation and human immunodeficiency virus gene expression
12368300 fluctuation in CycT1 levels during human macrophage differentiation may be involved in the regulation of HIV-1 replication
12368300 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
12177005 P-TEFb is a key mediator of Myc activated transcription by stimulating elongation
12115727 CDK9 has the intrinsic property to shuttle between nucleus and cytoplasm, and enhanced expression of cyclin T1 promotes its nuclear localization.
12052871 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11884399 P-TEFb containing cyclin K and Cdk9 can activate transcription via RNA.
11809800 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11780068 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11739686 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11730934 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11713533 Activity inhibited by 7SK small nuclear RNA.
11704662 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11689614 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11549886 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11547919 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11504720 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11455589 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11282025 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11118314 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11112772 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
11080476 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10964778 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10958691 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10944537 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10931842 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10913173 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10866664 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10757782 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10671520 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10661406 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10617616 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10545121 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10536359 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10467404 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10465067 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10454543 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10438593 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10393900 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10393184 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10384302 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10377393 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10364329 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10364292 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10329126 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10329125 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10082552 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10077579 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10066804 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
10049833 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9990016 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9843510 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9832504 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9811724 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9765201 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9696809 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9651670 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9649438 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9570510 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9557739 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9491887 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9356449 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9334326 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
9334325 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
8849451 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
8676484 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation
7853496 Cyclin T1 mutant N60A fails to bind to HIV-1 Tat and impairs the effect on Tat-mediated transactivation, but H183A mutant exhibits Tat-binding activity and partially disrupts Tat-mediated transactivation

AA Sequence

MEGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQRLNVSQLTINTAIVYMHRFY      1 - 70
MIQSFTQFPGNSVAPAALFLAAKVEEQPKKLEHVIKVAHTCLHPQESLPDTRSEAYLQQVQDLVILESII     71 - 140
LQTLGFELTIDHPHTHVVKCTQLVRASKDLAQTSYFMATNSLHLTTFSLQYTPPVVACVCIHLACKWSNW    141 - 210
EIPVSTDGKHWWEYVDATVTLELLDELTHEFLQILEKTPNRLKRIWNWRACEAAKKTKADDRGTDEKTSE    211 - 280
QTILNMISQSSSDTTIAGLMSMSTSTTSAVPSLPVSEESSSNLTSVEMLPGKRWLSSQPSFKLEPTQGHR    281 - 350
TSENLALTGVDHSLPQDGSNAFISQKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENMEANVKSQYAY    351 - 420
AAQNLLSHHDSHSSVILKMPIEGSENPERPFLEKADKTALKMRIPVAGGDKAASSKPEEIKMRIKVHAAA    421 - 490
DKHNSVEDSVTKSREHKEKHKTHPSNHHHHHNHHSHKHSHSQLPVGTGNKRPGDPKHSSQTSNLAHKTYS    491 - 560
LSSSFSSSSSTRKRGPSEETGGAVFDHPAKIAKSTKSSSLNFSFPSLPTMGQMPGHSSDTSGLSFSQPSC    561 - 630
KTRVPHSKLDKGPTGANGHNTTQTIDYQDTVNMLHSLLSAQGVQPTQPTAFEFVRPYSDYLNPRSGGISS    631 - 700
RSGNTDKPRPPPLPSEPPPPLPPLPK                                                701 - 726
//

Text Mined References (193)

PMID Year Title
25909811 2015 Determining the Functions of HIV-1 Tat and a Second Magnesium Ion in the CDK9/Cyclin T1 Complex: A Molecular Dynamics Simulation Study.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
25116364 2014 NUCKS1, a novel Tat coactivator, plays a crucial role in HIV-1 replication by increasing Tat-mediated viral transcription on the HIV-1 LTR promoter.
24515107 2014 Release of positive transcription elongation factor b (P-TEFb) from 7SK small nuclear ribonucleoprotein (snRNP) activates hexamethylene bisacetamide-inducible protein (HEXIM1) transcription.
24351800 2013 The cyclin-dependent kinase ortholog pUL97 of human cytomegalovirus interacts with cyclins.
23977272 2013 Polo-like kinase 1 inhibits the activity of positive transcription elongation factor of RNA Pol II b (P-TEFb).
23691059 2013 Mice transgenic for CD4-specific human CD4, CCR5 and cyclin T1 expression: a new model for investigating HIV-1 transmission and treatment efficacy.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23569210 2013 Inhibition of HIV-1 transcription and replication by a newly identified cyclin T1 splice variant.
23539624 2013 Histone deacetylase inhibitors (HDACis) that release the positive transcription elongation factor b (P-TEFb) from its inhibitory complex also activate HIV transcription.
23471103 2013 The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23296566 2013 Computational study and peptide inhibitors design for the CDK9 - cyclin T1 complex.
23274668 2013 Identification of novel inhibitors of human immunodeficiency virus type 1 replication by in silico screening targeting cyclin T1/Tat interaction.
23251033 2013 HIV-1 Tat recruits transcription elongation factors dispersed along a flexible AFF4 scaffold.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23152527 2013 Cyclin T1 and CDK9 T-loop phosphorylation are downregulated during establishment of HIV-1 latency in primary resting memory CD4+ T cells.
23110726 2012 Identification of novel CDK9 and Cyclin T1-associated protein complexes (CCAPs) whose siRNA depletion enhances HIV-1 Tat function.
23064645 2012 Cyclin-dependent kinase control of the initiation-to-elongation switch of RNA polymerase II.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22959624 2012 The CDK9 tail determines the reaction pathway of positive transcription elongation factor b.
22771113 2012 Use of ATP analogs to inhibit HIV-1 transcription.
22692005 2012 Regulation of cyclin T1 expression and function by an alternative splice variant that skips exon 7 and contains a premature termination codon.
22591364 2012 Modulation of intracellular restriction factors contributes to methamphetamine-mediated enhancement of acquired immune deficiency syndrome virus infection of macrophages.
22569018 2012 Preventing the formation of positive transcription elongation factor b by human cyclin T1-binding RNA aptamer for anti-HIV transcription.
22342181 2012 Functional characterization of a human cyclin T1 mutant reveals a different binding surface for Tat and HEXIM1.
22205749 2012 Regulation of cyclin T1 and HIV-1 Replication by microRNAs in resting CD4+ T lymphocytes.
22190034 2011 Global landscape of HIV-human protein complexes.
21763496 2011 HIV-1 replication and latency are regulated by translational control of cyclin T1.
21763494 2011 Functional characterization of human cyclin T1 N-terminal region for human immunodeficiency virus-1 Tat transcriptional activation.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
21555514 2011 Cyclin K inhibits HIV-1 gene expression and replication by interfering with cyclin-dependent kinase 9 (CDK9)-cyclin T1 interaction in Nef-dependent manner.
21450947 2011 Recruitment of cyclin-dependent kinase 9 to nuclear compartments during cytomegalovirus late replication: importance of an interaction between viral pUL69 and cyclin T1.
21269460 2011 Initial characterization of the human central proteome.
20943989 2010 Cyclin T1/CDK9 interacts with influenza A virus polymerase and facilitates its association with cellular RNA polymerase II.
20714219 2010 Cyclin T1 overexpression induces malignant transformation and tumor growth.
20618343 2010 Positive transcription elongation factor b (P-TEFb) contributes to dengue virus-stimulated induction of interleukin-8 (IL-8).
20210365 2010 A flexible bipartite coiled coil structure is required for the interaction of Hexim1 with the P-TEFB subunit cyclin T1.
20153263 2010 A higher-order complex containing AF4 and ENL family proteins with P-TEFb facilitates oncogenic and physiologic MLL-dependent transcription.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19914168 2009 Nuclear CDKs drive Smad transcriptional activation and turnover in BMP and TGF-beta pathways.
19883659 2010 Specificity of Hexim1 and Hexim2 complex formation with cyclin T1/T2, importin alpha and 7SK snRNA.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19575011 2009 CDK9 directs H2B monoubiquitination and controls replication-dependent histone mRNA 3'-end processing.
19387490 2009 Acetylation of cyclin T1 regulates the equilibrium between active and inactive P-TEFb in cells.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19297489 2009 Recruitment of cdk9 to the immediate-early viral transcriptosomes during human cytomegalovirus infection requires efficient binding to cyclin T1, a threshold level of IE2 86, and active transcription.
19179338 2009 Cyclin-dependent Kinases Phosphorylate the Cytomegalovirus RNA Export Protein pUL69 and Modulate Its Nuclear Localization and Activity.
18931076 2008 Dominant negative mutant cyclin T1 proteins that inhibit HIV transcription by forming a kinase inactive complex with Tat.
18780834 2008 Cross-talk of GATA-1 and P-TEFb in megakaryocyte differentiation.
18773076 2008 Cyclin T1-dependent genes in activated CD4 T and macrophage cell lines appear enriched in HIV-1 co-factors.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18620576 2008 Dominant negative mutant cyclin T1 proteins inhibit HIV transcription by specifically degrading Tat.
18566585 2008 The structure of P-TEFb (CDK9/cyclin T1), its complex with flavopiridol and regulation by phosphorylation.
18483487 2008 The La-related protein LARP7 is a component of the 7SK ribonucleoprotein and affects transcription of cellular and viral polymerase II genes.
18391197 2008 TFIID component TAF7 functionally interacts with both TFIIH and P-TEFb.
18353948 2008 Increased in vivo activation of microglia and astrocytes in the brains of mice transgenic for an infectious R5 human immunodeficiency virus type 1 provirus and for CD4-specific expression of human cyclin T1 in response to stimulation by lipopolysaccharides.
18205180 2008 Cdk9/Cyclin T1 complex: a key player during the activation/differentiation process of normal lymphoid B cells.
18039861 2008 Brd4 recruits P-TEFb to chromosomes at late mitosis to promote G1 gene expression and cell cycle progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17855633 2007 A role for the MLL fusion partner ENL in transcriptional elongation and chromatin modification.
17724342 2007 Structure of the Cyclin T binding domain of Hexim1 and molecular basis for its recognition of P-TEFb.
17690245 2007 Conserved P-TEFb-interacting domain of BRD4 inhibits HIV transcription.
17686863 2007 Modulation of the Brd4/P-TEFb interaction by the human T-lymphotropic virus type 1 tax protein.
17643375 2007 Systematic analysis of the protein interaction network for the human transcription machinery reveals the identity of the 7SK capping enzyme.
17540406 2007 Cyclin box structure of the P-TEFb subunit cyclin T1 derived from a fusion complex with EIAV tat.
17502349 2007 Differential regulation of NF-kappaB by elongation factors is determined by core promoter type.
17452463 2007 Regulation of P-TEFb elongation complex activity by CDK9 acetylation.
17352406 2007 The role of the Cdk9/Cyclin T1 complex in T cell differentiation.
17317667 2007 The Werner syndrome helicase is a cofactor for HIV-1 long terminal repeat transactivation and retroviral replication.
17289077 2007 Developmental regulators containing the I-mfa domain interact with T cyclins and Tat and modulate transcription.
17014716 2006 Effects of prostratin on Cyclin T1/P-TEFb function and the gene expression profile in primary resting CD4+ T cells.
16980611 2006 Modulation of a P-TEFb functional equilibrium for the global control of cell growth and differentiation.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16838299 2006 The regulation of HIV-1 transcription: molecular targets for chemotherapeutic intervention.
16764723 2006 Induction of the HIV-1 Tat co-factor cyclin T1 during monocyte differentiation is required for the regulated expression of a large portion of cellular mRNAs.
16615932 2006 HIV-1 Tat interaction with cyclin T1 represses mannose receptor and the bone morphogenetic protein receptor-2 transcription.
16601680 2006 Requirement for SWI/SNF chromatin-remodeling complex in Tat-mediated activation of the HIV-1 promoter.
16541075 2006 The finished DNA sequence of human chromosome 12.
16439541 2006 CD4-specific transgenic expression of human cyclin T1 markedly increases human immunodeficiency virus type 1 (HIV-1) production by CD4+ T lymphocytes and myeloid cells in mice transgenic for a provirus encoding a monocyte-tropic HIV-1 isolate.
16362050 2005 Interplay between 7SK snRNA and oppositely charged regions in HEXIM1 direct the inhibition of P-TEFb.
16308568 2005 P-TEFb is not an essential elongation factor for the intronless human U2 snRNA and histone H2b genes.
16135803 2005 p73 Interacts with human immunodeficiency virus type 1 Tat in astrocytic cells and prevents its acetylation on lysine 28.
16109377 2005 Recruitment of P-TEFb for stimulation of transcriptional elongation by the bromodomain protein Brd4.
16109376 2005 The bromodomain protein Brd4 is a positive regulatory component of P-TEFb and stimulates RNA polymerase II-dependent transcription.
15994294 2005 Transcription-dependent association of multiple positive transcription elongation factor units to a HEXIM multimer.
15940264 2005 The breast cell growth inhibitor, estrogen down regulated gene 1, modulates a novel functional interaction between estrogen receptor alpha and transcriptional elongation factor cyclin T1.
15913611 2005 Specific inhibition of HIV-1 replication by short hairpin RNAs targeting human cyclin T1 without inducing apoptosis.
15905409 2005 A human splicing factor, SKIP, associates with P-TEFb and enhances transcription elongation by HIV-1 Tat.
15713661 2005 Compensatory contributions of HEXIM1 and HEXIM2 in maintaining the balance of active and inactive positive transcription elongation factor b complexes for control of transcription.
15563843 2004 Transcriptional activity and substrate recognition of cyclin T2 from P-TEFb.
15528190 2005 Cyclin-dependent kinase 9 is required for tumor necrosis factor-alpha-stimulated matrix metalloproteinase-9 expression in human lung adenocarcinoma cells.
15107825 2004 BRCA1 cooperates with NUFIP and P-TEFb to activate transcription by RNA polymerase II.
15049426 2003 Regulation of TAK/P-TEFb in CD4+ T lymphocytes and macrophages.
14972556 2004 Evidence for conformational flexibility in the Tat-TAR recognition motif of cyclin T1.
14963154 2004 Inhibition of human immunodeficiency virus type 1 replication by RNA interference directed against human transcription elongation factor P-TEFb (CDK9/CyclinT1).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627702 2004 Phosphorylated positive transcription elongation factor b (P-TEFb) is tagged for inhibition through association with 7SK snRNA.
14580347 2003 Inhibition of P-TEFb (CDK9/Cyclin T) kinase and RNA polymerase II transcription by the coordinated actions of HEXIM1 and 7SK snRNA.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12944920 2003 c-Myc recruits P-TEFb for transcription, cellular proliferation and apoptosis.
12944466 2003 The human I-mfa domain-containing protein, HIC, interacts with cyclin T1 and modulates P-TEFb-dependent transcription.
12942536 2003 Catalytic activity of Cdk9 is required for nuclear co-localization of the Cdk9/cyclin T1 (P-TEFb) complex.
12917420 2003 Interactions between the aryl hydrocarbon receptor and P-TEFb. Sequential recruitment of transcription factors and differential phosphorylation of C-terminal domain of RNA polymerase II at cyp1a1 promoter.
12894230 2003 Functional inactivation of Cdk9 through oligomerization chain reaction.
12887902 2003 Acetylation of Tat defines a cyclinT1-independent step in HIV transactivation.
12832472 2003 MAQ1 and 7SK RNA interact with CDK9/cyclin T complexes in a transcription-dependent manner.
12753906 2003 Interaction of Sp1 transcription factor with HIV-1 Tat protein: looking for cellular partners.
12727882 2003 Recruitment of human cyclin T1 to nuclear bodies through direct interaction with the PML protein.
12676794 2003 The RNA polymerase II elongation complex.
12651893 2003 A model of repression: CTD analogs and PIE-1 inhibit transcriptional elongation by P-TEFb.
12588988 2003 The growth factor granulin interacts with cyclin T1 and modulates P-TEFb-dependent transcription.
12494448 2003 Cyclin T: three forms for different roles in physiological and pathological functions.
12486002 2002 Differential acetylation of Tat coordinates its interaction with the co-activators cyclin T1 and PCAF.
12458222 2003 Tat and trans-activation-responsive (TAR) RNA-independent induction of HIV-1 long terminal repeat by human and murine cyclin T1 requires Sp1.
12368330 2002 Optimized chimeras between kinase-inactive mutant Cdk9 and truncated cyclin T1 proteins efficiently inhibit Tat transactivation and human immunodeficiency virus gene expression.
12368300 2002 Transient induction of cyclin T1 during human macrophage differentiation regulates human immunodeficiency virus type 1 Tat transactivation function.
12177005 2002 Myc recruits P-TEFb to mediate the final step in the transcriptional activation of the cad promoter.
12115727 2002 CDK9 has the intrinsic property to shuttle between nucleus and cytoplasm, and enhanced expression of cyclin T1 promotes its nuclear localization.
12065898 MCEF, the newest member of the AF4 family of transcription factors involved in leukemia, is a positive transcription elongation factor-b-associated protein.
12052871 2002 Phosphorylation of the RNA polymerase II carboxyl-terminal domain by CDK9 is directly responsible for human immunodeficiency virus type 1 Tat-activated transcriptional elongation.
11884399 2002 P-TEFb containing cyclin K and Cdk9 can activate transcription via RNA.
11809800 2002 Spt5 cooperates with human immunodeficiency virus type 1 Tat by preventing premature RNA release at terminator sequences.
11780068 2001 Stimulatory effect of splicing factors on transcriptional elongation.
11739744 2002 Interaction between P-TEFb and the C-terminal domain of RNA polymerase II activates transcriptional elongation from sites upstream or downstream of target genes.
11739686 2002 Cyclin T1 expression is mediated by a complex and constitutively active promoter and does not limit human immunodeficiency virus type 1 Tat function in unstimulated primary lymphocytes.
11730934 2001 Functional interaction between cyclin T1/cdk9 and Puralpha determines the level of TNFalpha promoter activation by Tat in glial cells.
11713533 2001 7SK small nuclear RNA binds to and inhibits the activity of CDK9/cyclin T complexes.
11713532 2001 The 7SK small nuclear RNA inhibits the CDK9/cyclin T1 kinase to control transcription.
11704662 2002 Nuclear receptor coactivator p160 proteins enhance the HIV-1 long terminal repeat promoter by bridging promoter-bound factors and the Tat-P-TEFb complex.
11689688 2001 Interaction between cyclin T1 and SCF(SKP2) targets CDK9 for ubiquitination and degradation by the proteasome.
11689614 2001 Induction of TAK (cyclin T1/P-TEFb) in purified resting CD4(+) T lymphocytes by combination of cytokines.
11549886 2001 Binding of phage-displayed HIV-1 Tat to TAR RNA in the presence of cyclin T1.
11547919 2001 Multiple modes of transcriptional regulation by the HIV-1 Tat transactivator.
11545735 2001 NF-kappaB binds P-TEFb to stimulate transcriptional elongation by RNA polymerase II.
11504720 2001 Visualization of in vivo direct interaction between HIV-1 TAT and human cyclin T1 in specific subcellular compartments by fluorescence resonance energy transfer.
11373315 2001 Pattern of expression of cyclin T1 in human tissues.
11282025 2001 The Cdk9 and cyclin T subunits of TAK/P-TEFb localize to splicing factor-rich nuclear speckle regions.
11145967 2001 Positive transcription elongation factor B phosphorylates hSPT5 and RNA polymerase II carboxyl-terminal domain independently of cyclin-dependent kinase-activating kinase.
11118314 2000 Reciprocal modulation of transcriptional activities between HIV-1 Tat and MHC class II transactivator CIITA.
11112772 2001 DSIF and NELF interact with RNA polymerase II elongation complex and HIV-1 Tat stimulates P-TEFb-mediated phosphorylation of RNA polymerase II and DSIF during transcription elongation.
11080476 2000 Acetylation of HIV-1 Tat by CBP/P300 increases transcription of integrated HIV-1 genome and enhances binding to core histones.
10985245 2000 The level of HIV infection of macrophages is determined by interaction of viral and host cell genotypes.
10983978 2000 Direct coupling of transcription and mRNA processing through the thermogenic coactivator PGC-1.
10964778 2000 An in vitro transcription system that recapitulates equine infectious anemia virus tat-mediated inhibition of human immunodeficiency virus type 1 Tat activity demonstrates a role for positive transcription elongation factor b and associated proteins in the mechanism of Tat activation.
10958691 2000 CDK9 autophosphorylation regulates high-affinity binding of the human immunodeficiency virus type 1 tat-P-TEFb complex to TAR RNA.
10944537 2000 HIV-1 TAR RNA enhances the interaction between Tat and cyclin T1.
10931842 2000 Cooperative interaction between HIV-1 regulatory proteins Tat and Vpr modulates transcription of the viral genome.
10913173 2000 Relief of two built-In autoinhibitory mechanisms in P-TEFb is required for assembly of a multicomponent transcription elongation complex at the human immunodeficiency virus type 1 promoter.
10903436 2000 Isolation and characterization of the human cyclin T1 promoter.
10866664 2000 Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.
10757782 2000 Domains in the SPT5 protein that modulate its transcriptional regulatory properties.
10671520 2000 Molecular cloning of a novel human I-mfa domain-containing protein that differently regulates human T-cell leukemia virus type I and HIV-1 expression.
10661406 2000 Tat competes with CIITA for the binding to P-TEFb and blocks the expression of MHC class II genes in HIV infection.
10617616 2000 Requirement for a kinase-specific chaperone pathway in the production of a Cdk9/cyclin T1 heterodimer responsible for P-TEFb-mediated tat stimulation of HIV-1 transcription.
10574912 1999 Cyclin K functions as a CDK9 regulatory subunit and participates in RNA polymerase II transcription.
10545121 1999 HIV-1 tat transcriptional activity is regulated by acetylation.
10536359 1999 Regulatory functions of Cdk9 and of cyclin T1 in HIV tat transactivation pathway gene expression.
10467404 1999 Transcriptional regulation by targeted recruitment of cyclin-dependent CDK9 kinase in vivo.
10465067 1999 The CDK9-associated cyclins T1 and T2 exert opposite effects on HIV-1 Tat activity.
10454543 1999 Tat-SF1 protein associates with RAP30 and human SPT5 proteins.
10438593 1999 Direct evidence that HIV-1 Tat stimulates RNA polymerase II carboxyl-terminal domain hyperphosphorylation during transcriptional elongation.
10393900 1999 Recruitment of cyclin T1/P-TEFb to an HIV type 1 long terminal repeat promoter proximal RNA target is both necessary and sufficient for full activation of transcription.
10393184 1999 A novel RNA polymerase II-containing complex potentiates Tat-enhanced HIV-1 transcription.
10384302 1998 HIV-1 Tat interacts with cyclin T1 to direct the P-TEFb CTD kinase complex to TAR RNA.
10377393 1999 Host-cell positive transcription elongation factor b kinase activity is essential and limiting for HIV type 1 replication.
10364329 1999 Analysis of the effect of natural sequence variation in Tat and in cyclin T on the formation and RNA binding properties of Tat-cyclin T complexes.
10364292 1999 Human and rodent transcription elongation factor P-TEFb: interactions with human immunodeficiency virus type 1 tat and carboxy-terminal domain substrate.
10329126 1999 Role of the human and murine cyclin T proteins in regulating HIV-1 tat-activation.
10329125 1999 Cyclin T1 domains involved in complex formation with Tat and TAR RNA are critical for tat-activation.
10082552 1999 Tat activates human immunodeficiency virus type 1 transcriptional elongation independent of TFIIH kinase.
10077579 1999 Specific interaction of Tat with the human but not rodent P-TEFb complex mediates the species-specific Tat activation of HIV-1 transcription.
10066804 1999 Tat-associated kinase (P-TEFb): a component of transcription preinitiation and elongation complexes.
10049833 1999 Interactions between Tat and TAR and human immunodeficiency virus replication are facilitated by human cyclin T1 but not cyclins T2a or T2b.
9990016 1999 Interactions between human cyclin T, Tat, and the transactivation response element (TAR) are disrupted by a cysteine to tyrosine substitution found in mouse cyclin T.
9872325 1998 Upregulation of cyclin T1/CDK9 complexes during T cell activation.
9843510 1998 Recruitment of a protein complex containing Tat and cyclin T1 to TAR governs the species specificity of HIV-1 Tat.
9832504 1998 The interaction between HIV-1 Tat and human cyclin T1 requires zinc and a critical cysteine residue that is not conserved in the murine CycT1 protein.
9811724 1998 Tat-associated kinase, TAK, activity is regulated by distinct mechanisms in peripheral blood lymphocytes and promonocytic cell lines.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9696809 1998 The ability of positive transcription elongation factor B to transactivate human immunodeficiency virus transcription depends on a functional kinase domain, cyclin T1, and Tat.
9651670 1998 Transcriptional control: Tat cofactors and transcriptional elongation.
9649438 1998 Transcription elongation factor P-TEFb mediates Tat activation of HIV-1 transcription at multiple stages.
9570510 1998 Tat, Tat-associated kinase, and transcription.
9557739 1998 PITALRE, the catalytic subunit of TAK, is required for human immunodeficiency virus Tat transactivation in vivo.
9499409 1998 Identification of multiple cyclin subunits of human P-TEFb.
9491887 1998 A novel CDK9-associated C-type cyclin interacts directly with HIV-1 Tat and mediates its high-affinity, loop-specific binding to TAR RNA.
9356449 1997 TAK, an HIV Tat-associated kinase, is a member of the cyclin-dependent family of protein kinases and is induced by activation of peripheral blood lymphocytes and differentiation of promonocytic cell lines.
9334326 1997 P-TEFb kinase is required for HIV Tat transcriptional activation in vivo and in vitro.
9334325 1997 Transcription elongation factor P-TEFb is required for HIV-1 tat transactivation in vitro.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8676484 1996 The human immunodeficiency virus Tat proteins specifically associate with TAK in vivo and require the carboxyl-terminal domain of RNA polymerase II for function.
7853496 1995 Lentivirus Tat proteins specifically associate with a cellular protein kinase, TAK, that hyperphosphorylates the carboxyl-terminal domain of the large subunit of RNA polymerase II: candidate for a Tat cofactor.