Property Summary

NCBI Gene PubMed Count 16
PubMed Score 94.99
PubTator Score 6.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.100 5.6e-06
astrocytic glioma 1.700 4.7e-03
ependymoma 1.900 7.0e-03
oligodendroglioma 1.100 4.3e-03
psoriasis -1.200 1.3e-03
glioblastoma multiforme 1.100 2.6e-16
osteosarcoma -1.041 2.4e-03
group 3 medulloblastoma 1.400 7.4e-03
acute quadriplegic myopathy 1.101 4.2e-07
pancreatic ductal adenocarcinoma liver m... 1.730 1.1e-03
lung adenocarcinoma 1.100 1.2e-03
Pick disease -2.300 1.1e-06
progressive supranuclear palsy -1.800 6.1e-03
ovarian cancer -1.900 1.0e-08

Gene RIF (6)

PMID Text
25532805 Therefore, cyclin L2-mediated control of SAMHD1 levels in macrophages supports HIV-1 replication.
24218572 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
18216018 CDK11(p110) interacts physically and functionally with cyclin Lalpha and -beta isoforms and SR proteins to regulate splicing.
17494991 Data show that a green fluorescent protein (GFP) fusion protein of cyclin L1, in contrast to cyclin L2, was not mobile within the nucleus of living COS7 cells.
14684736 represents a new member of the cyclin family, which might regulate the transcription and RNA processing of certain apoptosis-related factors
14623875 characterize cyclin L2 as a highly mobile component of nuclear speckles and suggest that DYRK1A may regulate splicing by phosphorylation of cyclin L2

AA Sequence

MAAAAAAAGAAGSAAPAAAAGAPGSGGAPSGSQGVLIGDRLYSGVLITLENCLLPDDKLRFTPSMSSGLD      1 - 70
TDTETDLRVVGCELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRR     71 - 140
IRDVINVFHRLRQLRDKKKPVPLLLDQDYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECE    141 - 210
RNQHLVQTSWNYMNDSLRTDVFVRFQPESIACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICLKI    211 - 280
LQLYARKKVDLTHLEGEVEKRKHAIEEAKAQARGLLPGGTQVLDGTSGFSPAPKLVESPKEGKGSKPSPL    281 - 350
SVKNTKRRLEGAKKAKADSPVNGLPKGRESRSRSRSREQSYSRSPSRSASPKRRKSDSGSTSGGSKSQSR    351 - 420
SRSRSDSPPRQAPRSAPYKGSEIRGSRKSKDCKYPQKPHKSRSRSSSRSRSRSRERADNPGKYKKKSHYY    421 - 490
RDQRRERSRSYERTGRRYERDHPGHSRHRR                                            491 - 520
//

Text Mined References (25)

PMID Year Title
25532805 2015 Cyclin L2 is a critical HIV dependency factor in macrophages that controls SAMHD1 abundance.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24218572 2013 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18216018 2008 Characterization of cyclin L1 and L2 interactions with CDK11 and splicing factors: influence of cyclin L isoforms on splice site selection.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17494991 2007 Characterization of cyclin L1 as an immobile component of the splicing factor compartment.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14725631 2004 Cyclin S: a new member of the cyclin family plays a role in long-term memory.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684736 2004 Cyclin L2, a novel RNA polymerase II-associated cyclin, is involved in pre-mRNA splicing and induces apoptosis of human hepatocellular carcinoma cells.
14623875 2004 Characterization of cyclin L2, a novel cyclin with an arginine/serine-rich domain: phosphorylation by DYRK1A and colocalization with splicing factors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8838426 1996 Patterns of gene expression along the crypt-villus axis in mouse jejunal epithelium.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.