Property Summary

NCBI Gene PubMed Count 28
PubMed Score 6.65
PubTator Score 21.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 2.000 5.2e-03
hepatocellular carcinoma -1.100 2.1e-02
interstitial lung disease -1.300 4.4e-02
ependymoma 1.300 2.7e-02
glioblastoma 1.600 3.0e-03
autosomal dominant Emery-Dreifuss muscul... 1.146 2.5e-02
acute quadriplegic myopathy 1.357 2.5e-04
pancreatic ductal adenocarcinoma liver m... 1.351 2.6e-02
non-small cell lung cancer -1.013 5.5e-11
intraductal papillary-mucinous neoplasm ... 1.300 1.4e-03
lung cancer -1.800 1.2e-05
diabetes mellitus -1.300 4.3e-02
sonic hedgehog group medulloblastoma 1.300 1.4e-04
psoriasis -1.100 7.4e-04
Pick disease -2.200 1.2e-06
progressive supranuclear palsy -1.800 6.4e-03
Breast cancer -1.200 6.1e-19
invasive ductal carcinoma 1.100 5.6e-03
acute myeloid leukemia 1.100 9.1e-03
ovarian cancer -1.600 4.2e-07
pituitary cancer -1.400 6.8e-05

Gene RIF (14)

PMID Text
26043836 CCNL1 is the target gene of miR-199b-5p.
22685556 Data indicate that if the newborn carried a risk allele rs900400 near LEKR/CCNL1, the impact of stress on birth size was stronger.
22073261 birth weight lowering effect of the C-allele of rs900400 located near LEKR1 and CCNL1 was replicated in the Danish population. Furthermore the C-allele was associated with increased insulin response following oral glucose stimulation
21712988 Data show low birth weight in Asian Indians is not due to variation near CCNL1/ADCY5, but variant ADCY5 is associated with elevated glucose/decreased insulin response which suggests a common genetic cause of low birth weight and risk of type 2 diabetes.
21586274 These data demonstrate that there is a fine balance between CCNL1 and TIMP1, which may contribute to breast cancer development.
21307140 Our results suggest that a genetic variant of ccnl1 leads to symmetric growth restriction from early pregnancy onward
20721974 Cyclin L1 amplification is associated with uterine cervical carcinoma.
20372150 variants in ADCY5 and near CCNL1 are associated with fetal growth and birth weight
18216018 CDK11(p110) interacts physically and functionally with cyclin Lalpha and -beta isoforms and SR proteins to regulate splicing.
17494991 Data show that a green fluorescent protein (GFP) fusion protein of cyclin L1, in contrast to cyclin L2, was not mobile within the nucleus of living COS7 cells.
16598186 study suggests that cyclin l1 may have a role in RNA processing complex anc ould participate in tumor progression of head and neck squamous cell carcinoma
15700036 Our results indicate that CCNL1 plays a critical role in the loco-regional progression of HNSCC and may serve as an indicator for occult advanced tumour stages.
11980906 role in pre-mRNA splicing
11980906 Cyclin L has been shown to associate with the PITSLRE kinase and is involved in pre-mRNA processing.

AA Sequence

MASGPHSTATAAAAASSAAPSAGGSSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSM      1 - 70
QDGLDLPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIE     71 - 140
EAPRRIRDVINVFHHLRQLRGKRTPSPLILDQNYINTKNQVIKAERRVLKELGFCVHVKHPHKIIVMYLQ    141 - 210
VLECERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQIPLPTRPHWFLLFGTTEEEIQE    211 - 280
ICIETLRLYTRKKPNYELLEKEVEKRKVALQEAKLKAKGLNPDGTPALSTLGGFSPASKPSSPREVKAEE    281 - 350
KSPISINVKTVKKEPEDRQQASKSPYNGVRKDSKRSRNSRSASRSRSRTRSRSRSHTPRRHYNNRRSRSG    351 - 420
TYSSRSRSRSRSHSESPRRHHNHGSPHLKAKHTRDDLKSSNRHGHKRKKSRSRSQSKSRDHSDAAKKHRH    421 - 490
ERGHHRDRRERSRSFERSHKSKHHGGSRSGHGRHRR                                      491 - 526
//

Text Mined References (38)

PMID Year Title
26043836 2015 Overexpression of miR?199b?5p inhibits Ewing's sarcoma cell lines by targeting CCNL1.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23575227 2013 The chromosome 3q25 genomic region is associated with measures of adiposity in newborns in a multi-ethnic genome-wide association study.
23202124 2013 New loci associated with birth weight identify genetic links between intrauterine growth and adult height and metabolism.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22911880 2012 Genome-wide association analysis of eating disorder-related symptoms, behaviors, and personality traits.
22685556 2012 The interplay of variants near LEKR and CCNL1 and social stress in relation to birth size.
22073261 2011 The birth weight lowering C-allele of rs900400 near LEKR1 and CCNL1 associates with elevated insulin release following an oral glucose challenge.
21712988 2011 Absence of birth-weight lowering effect of ADCY5 and near CCNL, but association of impaired glucose-insulin homeostasis with ADCY5 in Asian Indians.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21586274 2011 A fine balance between CCNL1 and TIMP1 contributes to the development of breast cancer cells.
21441570 2011 Genome-wide meta-analysis for severe diabetic retinopathy.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21307140 2011 Variants near CCNL1/LEKR1 and in ADCY5 and fetal growth characteristics in different trimesters.
20721974 2010 Amplification of CyclinL1 in uterine cervical carcinoma has prognostic implications.
20372150 2010 Variants in ADCY5 and near CCNL1 are associated with fetal growth and birth weight.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18216018 2008 Characterization of cyclin L1 and L2 interactions with CDK11 and splicing factors: influence of cyclin L isoforms on splice site selection.
17494991 2007 Characterization of cyclin L1 as an immobile component of the splicing factor compartment.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16598186 2006 Cyclin L1 (CCNL1) gene alterations in human head and neck squamous cell carcinoma.
15700036 2005 Amplification of Cyclin L1 is associated with lymph node metastases in head and neck squamous cell carcinoma (HNSCC).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414649 2002 Amplicon mapping and transcriptional analysis pinpoint cyclin L as a candidate oncogene in head and neck cancer.
11980906 2002 Cyclin L is an RS domain protein involved in pre-mRNA splicing.
11683997 2001 Dopamine and glutamate induce distinct striatal splice forms of Ania-6, an RNA polymerase II-associated cyclin.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.