Property Summary

NCBI Gene PubMed Count 22
PubMed Score 15.31
PubTator Score 19.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -2.900 6.5e-06
osteosarcoma -1.121 3.5e-05
primary pancreatic ductal adenocarcinoma 1.241 9.3e-03
ovarian cancer 1.700 3.1e-05
pancreatic cancer 1.500 1.2e-03

 MGI Phenotype (1)

Gene RIF (13)

PMID Text
26597175 Structures of CDK12/CycK complexes solved in the presence of AMP-PNP.
25712099 Data show that most mutations prevent formation of the cyclin-dependent kinase 12 (Cdk12)/cyclin K (CycK) complex, rendering the kinase inactive.
25004108 that cyclin K may be a novel molecular link between germ cell development, cancer development and embryonic stem cell maintenance.
25004108 Cyclin K is highly expressed in mammalian testes in a developmentally regulated manner.
22988298 Cyclin K1 is the primary cyclin partner for CDK12/CrkRS and it is required for activation of CDK12/CrkRS to phosphorylate the C-terminal domain of RNA Pol II.
22547058 Cyclin K interacts with CDK12 and CDK13 but not CDK9 in cells, and is required to maintain self-renewal in ES cells.
21555514 Cyclin K inhibits HIV-1 gene expression and replication by interfering with cyclin-dependent kinase 9 (CDK9)-cyclin T1 interaction in Nef-dependent manner.
21555514 HIV-1 Nef induces cyclin K interaction with CDK9, which contributes to inhibit CDK9 nuclear translocation
20930849 These results reveal an unexpectedly direct role for CDK9-cyclin K in checkpoint pathways that maintain genome integrity in response to replication stress.
20459741 Cyclin K-expressing multiple myeloma LP-1 cells have lost their migration properties and display enhanced clonogenic capacities
17169370 The cyclin K fold comprises two typical cyclin boxes with two short helices preceding the N-terminal box. A prominent feature of cyclin K is an additional helix (H4a) in the first cyclin box that obstructs the binding pocket for the p27.
11988847 cyclin K may play a role in regulating the cell cycle or apoptosis
11884399 P-TEFb containing cyclin K and Cdk9 can activate transcription via RNA.

AA Sequence

MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDVGTRLGLHYDT      1 - 70
LATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTARSLLNDVQFGQFGDDPKEEV     71 - 140
MVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQKLVQMAWTFVNDSLCTTLSLQWEPEIIAVAV    141 - 210
MYLAGRLCKFEIQEWTSKPMYRRWWEQFVQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPSLQ    211 - 280
PTPQVPQVQQSQPSQSSEPSQPQQKDPQQPAQQQQPAQQPKKPSPQPSSPRQVKRAVVVSPKEENKAAEP    281 - 350
PPPKIPKIETTHPPLPPAHPPPDRKPPLAAALGEAEPPGPVDATDLPKVQIPPPAHPAPVHQPPPLPHRP    351 - 420
PPPPPSSYMTGMSTTSSYMSGEGYQSLQSMMKTEGPSYGALPPAYGPPAHLPYHPHVYPPNPPPPPVPPP    421 - 490
PASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPPHPPPGLGLPPASYPPPAVPPGGQPPVPP    491 - 560
PIPPPGMPPVGGLGRAAWMR                                                      561 - 580
//

Text Mined References (32)

PMID Year Title
26748711 2016 Structural and Functional Analysis of the Cdk13/Cyclin K Complex.
26597175 2015 Structures of the CDK12/CycK complex with AMP-PNP reveal a flexible C-terminal kinase extension important for ATP binding.
25712099 2015 Ovarian carcinoma CDK12 mutations misregulate expression of DNA repair genes via deficient formation and function of the Cdk12/CycK complex.
25416956 2014 A proteome-scale map of the human interactome network.
25004108 2014 A distinct expression pattern of cyclin K in mammalian testes suggests a functional role in spermatogenesis.
24662513 2014 The structure and substrate specificity of human Cdk12/Cyclin K.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22988298 2012 Interaction of cyclin-dependent kinase 12/CrkRS with cyclin K1 is required for the phosphorylation of the C-terminal domain of RNA polymerase II.
22547058 2012 Cyclin K-containing kinase complexes maintain self-renewal in murine embryonic stem cells.
22012619 2011 The Cyclin K/Cdk12 complex maintains genomic stability via regulation of expression of DNA damage response genes.
21555514 2011 Cyclin K inhibits HIV-1 gene expression and replication by interfering with cyclin-dependent kinase 9 (CDK9)-cyclin T1 interaction in Nef-dependent manner.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20930849 2010 Cyclin-dependent kinase 9-cyclin K functions in the replication stress response.
20459741 2010 Cyclin K and cyclin D1b are oncogenic in myeloma cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17169370 2007 Crystal structure of human cyclin K, a positive regulator of cyclin-dependent kinase 9.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11988847 Cyclin K as a direct transcriptional target of the p53 tumor suppressor.
11884399 2002 P-TEFb containing cyclin K and Cdk9 can activate transcription via RNA.
10574912 1999 Cyclin K functions as a CDK9 regulatory subunit and participates in RNA polymerase II transcription.
9632813 1998 Human cyclin K, a novel RNA polymerase II-associated cyclin possessing both carboxy-terminal domain kinase and Cdk-activating kinase activity.