Property Summary

NCBI Gene PubMed Count 33
PubMed Score 47.64
PubTator Score 42.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (33)

Gene RIF (30)

PMID Text
26573378 Upregulation of miR1246 mediated the malignant progression of colorectal cancer and is partly attributed to the downregulation of the expression of CycG2.
26149128 Neisseria meningitidis caused changes in the abundance of several cell cycle regulatory mRNAs, including the cell cycle inhibitors p21(WAF1/CIP1) and cyclin G2 in human brain microvascular endothelial cells.
25309979 miR-93-CCNG2 axis may be involved in Laryngeal squamous cell carcinoma proliferation and progression.
25122062 Data (from studies using BeWo cells, a choriocarcinoma cell line, as model of placentation) suggest that miR-378a-5p (microRNA 378a) inhibits cell differentiation in syncytiotrophoblasts, in part, by down-regulating CCNG2 (cyclin G2) expression.
25117811 miR-1246 expression was associated with chemoresistance and CSC-like properties via CCNG2, and could predict worse prognosis in pancreatic cancer patients
24708911 Data shows the human CCNG2 and CDK4 expression of visceral adipose tissue are inversely associated with glucose and insulin resistance.
24339739 Cyclin G2-involved invasion in vitro and in vivo.
24307622 The level of CCNG2 was correlated with T stages, lymph node metastasis, clinic stage, and histological grade (P < 0.05) in colorectal carcinoma.
24297335 CCNG2 may play important roles as a negative regulator to esophageal cancer cell by promoting degradation of CDK2.
24293374 CCNG2 expression decreased in prostate cancer and correlated significantly with lymph node metastasis, clinic stage, and Gleason score.
24289643 Low CCNG2 expression is associated with thyroid cancer.
24272084 CCNG2 may play important roles as a negative regulator to kidney cancer ACHN cell by promoting degradation of CDK2.
24248541 CCNG2 expression decreased in gastric cancer and correlated significantly T stages, lymph node metastasis, clinical stage, histological grade, and poor overall survival
24059861 Regulation of cyclin G2 is a key mechanism whereby insulin, insulin analogues and IGF-I stimulate cell proliferation.
22596188 These findings show that FOXA1, but not ER- alpha, is essential for AHR(aryl hydrocarbon receptor) -dependent regulation of CCNG2(cyclin G2 ), assigning a role for FOXA1 in AHR action.
22589537 Our results suggest that CycG2 contributes to DNA damage-induced G(2)/M checkpoint by enforcing checkpoint inhibition of CycB1-Cdc2 complexes.
21688120 Expression of cyclin G1 and G2 is strongly associated with nasopharyngeal carcinoma cell differentiation.
21532621 These findings showed that Nodal signaling promotes cyclin G2 transcription by upregulating FoxO3a expression, inhibiting FoxO3a phosphorylation and enhancing its synergistic interaction with Smads.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19738611 Observational study of gene-disease association. (HuGE Navigator)
19559447 Cyclin G2 appears to be a negative cell-cycle regulator in gastric cancer, and its expression seems to be inversely related to gastric cancer progression.
19460752 Knockdown of cyclin G2 (CCNG2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18784254 The antiproliferative effect of Nodal/ALK7 on ovarian cancer cells is in part mediated by cyclin G2.
18754885 our results suggest that cotylenin A and rapamycin induce inhibition of cancer cell growth through the induction of cyclin G2.
18025271 Cyclin G2 expression is modulated by HER2 signaling through multiple pathways including phosphoinositide 3-kinase, c-jun NH(2)-terminal kinase, and mTOR signaling.
17123511 Cyclin G2 may modulate the cell cycle and cellular division processes through modulation of PP2A and centrosomal associated activities.
16608856 Estrogen-occupied estrogen receptor represses cyclin G2 gene expression and recruits a repressor complex at the cyclin G2 promoter
16364039 Involved in progression and regulation of telomerase
12452053 ectopic expression of cyclin G2 inhibits cell proliferation
11956189 cyclin G2 also associates with various PP2A B' regulatory subunits, as previously shown for cyclin G1

AA Sequence

MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKVEDLRSLANFF      1 - 70
GSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIPSTHDVIRISQCKCTASDIKR     71 - 140
MEKIISEKLHYELEATTALNFLHLYHTIILCHTSERKEILSLDKLEAQLKACNCRLIFSKAKPSVLALCL    141 - 210
LNLEVETLKSVELLEILLLVKKHSKINDTEFFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNL    211 - 280
HNSYYSVPELPTIPEGGCFDESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS          281 - 344
//

Text Mined References (34)

PMID Year Title
26573378 2016 MicroRNA-1246 promotes growth and metastasis of colorectal cancer cells involving CCNG2 reduction.
26149128 2016 Neisseria meningitidis causes cell cycle arrest of human brain microvascular endothelial cells at S phase via p21 and cyclin G2.
25309979 2015 MicroRNA-93 regulates cyclin G2 expression and plays an oncogenic role in laryngeal squamous cell carcinoma.
25122062 2014 MicroRNA-378a-5p targets cyclin G2 to inhibit fusion and differentiation in BeWo cells.
25117811 2014 MicroRNA-1246 expression associated with CCNG2-mediated chemoresistance and stemness in pancreatic cancer.
24708911 CCNG2 and CDK4 is associated with insulin resistance in adipose tissue.
24339739 2013 Cyclin G2 promotes hypoxia-driven local invasion of glioblastoma by orchestrating cytoskeletal dynamics.
24307622 2014 CCNG2 expression is downregulated in colorectal carcinoma and its clinical significance.
24297335 2014 Changes in the expression of cyclin G2 in esophageal cancer cell and its significance.
24293374 2014 Effect of cyclin G2 on proliferative ability of prostate cancer PC-3 cell.
24289643 2013 CCNG2 suppressor biological effects on thyroid cancer cell through promotion of CDK2 degradation.
24272084 2014 Change in expression of cyclin G2 in kidney cancer cell and its significance.
24248541 2014 Decreased expression of CCNG2 is significantly linked to the malignant transformation of gastric carcinoma.
24059861 2014 Down-regulation of cyclin G2 by insulin, IGF-I (insulin-like growth factor 1) and X10 (AspB10 insulin): role in mitogenesis.
22596188 2012 FOXA1 is essential for aryl hydrocarbon receptor-dependent regulation of cyclin G2.
22589537 2012 Elevated cyclin G2 expression intersects with DNA damage checkpoint signaling and is required for a potent G2/M checkpoint arrest response to doxorubicin.
21688120 2012 The expression of cyclin G in nasopharyngeal carcinoma and its significance.
21532621 2011 Nodal enhances the activity of FoxO3a and its synergistic interaction with Smads to regulate cyclin G2 transcription in ovarian cancer cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19559447 2009 Expression levels of cyclin G2, but not cyclin E, correlate with gastric cancer progression.
18784254 2008 Cyclin G2 is degraded through the ubiquitin-proteasome pathway and mediates the antiproliferative effect of activin receptor-like kinase 7.
18754885 2008 Cotylenin A, a new differentiation inducer, and rapamycin cooperatively inhibit growth of cancer cells through induction of cyclin G2.
18025271 2007 Roles of human epidermal growth factor receptor 2, c-jun NH2-terminal kinase, phosphoinositide 3-kinase, and p70 S6 kinase pathways in regulation of cyclin G2 expression in human breast cancer cells.
17123511 2006 Cyclin G2 is a centrosome-associated nucleocytoplasmic shuttling protein that influences microtubule stability and induces a p53-dependent cell cycle arrest.
16608856 2006 Estrogen-occupied estrogen receptor represses cyclin G2 gene expression and recruits a repressor complex at the cyclin G2 promoter.
16364039 2006 Genes associated with telomerase activity levels in esophageal carcinoma cell lines.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12452053 2002 [Ectopic expression of cyclin G2 inhibits cell proliferation in HeLa cancer cell line].
11956189 2002 Cyclin G2 associates with protein phosphatase 2A catalytic and regulatory B' subunits in active complexes and induces nuclear aberrations and a G1/S phase cell cycle arrest.
8806701 1996 Characterisation of human cyclin G1 and G2: DNA damage inducible genes.
8626390 1996 Cyclin G1 and cyclin G2 comprise a new family of cyclins with contrasting tissue-specific and cell cycle-regulated expression.