Property Summary

NCBI Gene PubMed Count 38
PubMed Score 83.17
PubTator Score 69.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.542 2.6e-03
Multiple myeloma 2.026 1.4e-03
glioblastoma 1.100 1.6e-03
atypical teratoid / rhabdoid tumor 1.500 6.0e-07
medulloblastoma, large-cell 1.600 4.1e-05
ulcerative colitis -1.110 1.2e-03
primary pancreatic ductal adenocarcinoma -1.192 1.1e-03
sonic hedgehog group medulloblastoma 1.300 1.2e-06
ovarian cancer -2.200 2.0e-07
Breast cancer -1.200 6.2e-05
pancreatic cancer -1.200 3.4e-03

Protein-protein Interaction (9)

Gene RIF (23)

PMID Text
26872615 Results show that miR-23b may inhibit epithelial ovarian tumorigenesis and progression by targeting CCNG1 and modulating the expression of the relevant genes.
26623719 Data show that the miR-27b/cyclin G1 protein (CCNG1)/p53 tumor suppressor protein (P53)/miR-508-5p axis plays important roles in gastric cancer (GC)-associated multidrug resistance (MDR).
25472877 OA induced cell cycle arrest in lung cancer cells through miR-122/Cyclin G1/MEF2D pathway. This finding may contribute to the understanding of the molecular mechanism of OA's anti-tumor activity
25007270 Progesterone-induced cyclin G1 mediates the inhibitory effect of progesterone on endometrial epithelial cell proliferation.
23812426 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
23589924 cyclin G1 exerts negative control on proliferation of endometrial carcinoma cells (ECCs).
22835824 cyclin G1 levels were increased in normal tissue compared with hepatocellular carcinoma tissue and vary over the course of the cell cycle, with equal distribution between the nucleus and cytoplasm.
22649121 data suggest that the deficiency of progesterone and its receptors is an important cause of the decreased expression of cyclin G1 in endometrial carcinoma, which may account for carcinogenesis and development of endometrial carcinomas
22271581 Cyclin G1 overexpression enhanced Akt activation through interaction with p85 (regulatory subunit of phosphoinositide 3-kinase)
22105316 Loss of microRNA 122 expression in patients with hepatitis B enhances hepatitis B virus replication through cyclin G(1) -modulated P53 activity.
21688120 Expression of cyclin G1 and G2 is strongly associated with nasopharyngeal carcinoma cell differentiation.
19738611 Observational study of gene-disease association. (HuGE Navigator)
19698214 Low expression of P27(kip1) and the high expression of cyclin G in patients acute leukemia may have some correlation with genesis and development of the disease.
19584283 Results show that in patients resected for HCC, lower miR-122 levels were associated with a shorter TTR, whereas higher cyclin G1 expression was related to a lower survival, suggesting that miR-122 might represent an effective molecular target for HCC.
18981217 The B'alpha1 subunit of the serine/threonine protein phosphatase 2A, which binds to cyclin G1, can stabilize cyclin G1 under unstressed conditions and upon DNA damage, as well as inhibit the ability of cyclin G1 to be ubiquitinated.
18632610 the cyclin box has a role in the proteasome-mediated degradation of cyclin G1
18408012 Cdk5 activation in cells that overexpress cyclin G1 leads to c-Myc phosphorylation on Ser-62, which is responsible for cyclin G1-mediated transcriptional activation of cyclin B1.
17868090 Review of cyclin D1 and cyclin G and CDK acitivty and their roles in cancer pathogenesis, and their proteosomal degradation pathways as targets for cancer therapy
17616664 cyclin G1 is a target of miR-122a in human hepatocellular carcinoma
16322753 Cyclin G1 enhanced radiation sensitivity by overriding radiation-induced G2 arrest through transcriptional upregulation of cyclin B1.
15077171 cyclin G has a role in ATM-dependent p53 regulation and in cell cycle regulation during DNA damage
12684677 does not increase significantly during colorectal carcinogenesis and during later metastasis to lymph nodes.
12556559 cyclin G1 has growth inhibitory activity that is mechanistically linked to ARF-p53 and pRb tumor suppressor pathways.

AA Sequence

MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDT      1 - 70
ETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI     71 - 140
VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKACHCRIIFSKAKPSVLALSIIAL    141 - 210
EIQAQKCVELTEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHS    211 - 280
YYRITHLPTIPEMVP                                                           281 - 295
//

Text Mined References (40)

PMID Year Title
26872615 2016 MiR-23b targets cyclin G1 and suppresses ovarian cancer tumorigenesis and progression.
26623719 2016 The miR27b-CCNG1-P53-miR-508-5p axis regulates multidrug resistance of gastric cancer.
25472877 2015 Oleanolic acid suppresses the proliferation of lung carcinoma cells by miR-122/Cyclin G1/MEF2D axis.
25416956 2014 A proteome-scale map of the human interactome network.
25007270 2014 Progesterone-induced cyclin G1 inhibits the proliferation of endometrial epithelial cell and its possible molecular mechanism.
23812426 2014 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
23589924 2013 Effects of expression of exogenous cyclin G1 on proliferation of human endometrial carcinoma cells.
22835824 The relationship between Cyclin G1 and survival in patients treated surgically for HCC.
22649121 2012 The role of progesterone and its receptor on cyclin G1 expression in endometrial carcinoma cells.
22271581 2012 Cyclin G1-mediated epithelial-mesenchymal transition via phosphoinositide 3-kinase/Akt signaling facilitates liver cancer progression.
22105316 2012 Loss of microRNA 122 expression in patients with hepatitis B enhances hepatitis B virus replication through cyclin G(1) -modulated P53 activity.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21688120 2012 The expression of cyclin G in nasopharyngeal carcinoma and its significance.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19698214 2009 [Expression of P27(kip1) and cyclin G in patients with acute leukemia and its correlation].
19584283 2009 MiR-122/cyclin G1 interaction modulates p53 activity and affects doxorubicin sensitivity of human hepatocarcinoma cells.
18981217 2009 Lysine-independent turnover of cyclin G1 can be stabilized by B'alpha subunits of protein phosphatase 2A.
18632610 2008 A role for the cyclin box in the ubiquitin-mediated degradation of cyclin G1.
18408012 2008 Cdk5-mediated phosphorylation of c-Myc on Ser-62 is essential in transcriptional activation of cyclin B1 by cyclin G1.
17868090 2007 Cyclin degradation for cancer therapy and chemoprevention.
17616664 2007 Cyclin G1 is a target of miR-122a, a microRNA frequently down-regulated in human hepatocellular carcinoma.
16322753 2006 Cyclin G1 overcomes radiation-induced G2 arrest and increases cell death through transcriptional activation of cyclin B1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15077171 2004 The negative role of cyclin G in ATM-dependent p53 activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12684677 2003 Cyclin B1, unlike cyclin G1, increases significantly during colorectal carcinogenesis and during later metastasis to lymph nodes.
12634633 2003 Increased expression of cyclin G1 in leiomyoma compared with normal myometrium.
12556559 2003 Cyclin G1 has growth inhibitory activity linked to the ARF-Mdm2-p53 and pRb tumor suppressor pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12214116 1999 Increased Cyclin G1 Immunoreactivity During Alzheimer's Disease.
11956189 2002 Cyclin G2 associates with protein phosphatase 2A catalytic and regulatory B' subunits in active complexes and induces nuclear aberrations and a G1/S phase cell cycle arrest.
10196184 1999 Altered regulation of cyclin G in human breast cancer and its specific localization at replication foci in response to DNA damage in p53+/+ cells.
10194136 1999 The mechanisms of death of an erythroleukemic cell line by p53: involvement of the microtubule and mitochondria.
9013862 1997 GAK: a cyclin G associated kinase contains a tensin/auxilin-like domain.
8954786 1996 Structure and chromosomal assignment of the human cyclin G gene.
8887688 1996 p53-dependent association between cyclin G and the B' subunit of protein phosphatase 2A.
8806701 1996 Characterisation of human cyclin G1 and G2: DNA damage inducible genes.
8626390 1996 Cyclin G1 and cyclin G2 comprise a new family of cyclins with contrasting tissue-specific and cell cycle-regulated expression.