Property Summary

NCBI Gene PubMed Count 21
PubMed Score 38.34
PubTator Score 13.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Atopic dermatitis 1.100 3.6e-04
Breast cancer 1.200 3.8e-19
colon cancer 1.500 1.2e-03
lung cancer 1.300 1.4e-02
malignant mesothelioma 1.500 3.4e-07
medulloblastoma, large-cell 1.400 7.6e-05
non-small cell lung cancer 1.036 1.2e-19
osteosarcoma -3.275 1.8e-08
psoriasis -1.100 5.1e-03

Gene RIF (11)

AA Sequence

MGSGGVVHCRCAKCFCYPTKRRIRRRPRNLTILSLPEDVLFHILKWLSVEDILAVRAVHSQLKDLVDNHA      1 - 70
SVWACASFQELWPSPGNLKLFERAAEKGNFEAAVKLGIAYLYNEGLSVSDEARAEVNGLKASRFFSLAER     71 - 140
LNVGAAPFIWLFIRPPWSVSGSCCKAVVHESLRAECQLQRTHKASILHCLGRVLSLFEDEEKQQQAHDLF    141 - 210
EEAAHQGCLTSSYLLWESDRRTDVSDPGRCLHSFRKLRDYAAKGCWEAQLSLAKACANANQLGLEVRASS    211 - 280
EIVCQLFQASQAVSKQQVFSVQKGLNDTMRYILIDWLVEVATMKDFTSLCLHLTVECVDRYLRRRLVPRY    281 - 350
RLQLLGIACMVICTRFISKEILTIREAVWLTDNTYKYEDLVRMMGEIVSALEGKIRVPTVVDYKEVLLTL    351 - 420
VPVELRTQHLCSFLCELSLLHTSLSAYAPARLAAAALLLARLTHGQTQPWTTQLWDLTGFSYEDLIPCVL    421 - 490
SLHKKCFHDDAPKDYRQVSLTAVKQRFEDKRYGEISQEEVLSYSQLCAALGVTQDSPDPPTFLSTGEIHA    491 - 560
FLSSPSGRRTKRKRENSLQEDRGSFVTTPTAELSSQEETLLGSFLDWSLDCCSGYEGDQESEGEKEGDVT    561 - 630
APSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVRTSREPGKDVTTS    631 - 700
GYSSVSTASPTSSVDGGLGALPQPTSVLSLDSDSHTQPCHHQARKSCLQCRPPSPPESSVPQQQVKRINL    701 - 770
CIHSEEEDMNLGLVRL                                                          771 - 786
//

Text Mined References (23)

PMID Year Title