Property Summary

NCBI Gene PubMed Count 35
PubMed Score 50.27
PubTator Score 51.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Endometriosis 1.529 4.7e-02
malignant mesothelioma 2.100 1.6e-07
glioblastoma 1.800 1.7e-03
group 3 medulloblastoma 2.100 5.0e-03
atypical teratoid / rhabdoid tumor 1.200 1.6e-03
medulloblastoma, large-cell 2.700 4.5e-07
primitive neuroectodermal tumor 1.900 4.3e-03
Atopic dermatitis 1.200 9.4e-04
adrenocortical carcinoma 1.527 3.1e-03
non-small cell lung cancer 2.064 2.3e-22
intraductal papillary-mucinous carcinoma... 1.500 4.5e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.1e-03
lung cancer 3.200 6.2e-06
active Crohn's disease 1.029 4.3e-02
Breast cancer 3.700 2.4e-02
pediatric high grade glioma 1.400 1.0e-02
psoriasis 1.500 7.7e-12
subependymal giant cell astrocytoma -1.404 3.2e-02
nasopharyngeal carcinoma 2.000 7.2e-07
lung adenocarcinoma 1.281 1.2e-02
breast carcinoma 2.000 4.0e-44
Pick disease -1.100 2.3e-02
progressive supranuclear palsy -1.500 2.2e-02
ductal carcinoma in situ 2.700 7.2e-04
invasive ductal carcinoma 3.600 2.9e-05
ovarian cancer 1.800 3.3e-04

Protein-protein Interaction (5)

Gene RIF (20)

PMID Text
26818545 miR-26a regulated mouse hepatocyte proliferation by directly targeting the 3' untranslated regions of cyclin D2/cyclin E2.
26600399 Survivin and cyclin E2 genes expression may have clinical relevance and can be considered as molecular risk factors for AL. Also they may be useful as predictive markers for treatment outcome in leukemic patients.
26265440 In breast cancer patients, high levels of HMGA1 and CCNE2 expression are associated with the YAP/TAZ signature.
26057453 miR-144-5p functions as tumour suppressor in BC cells. CCNE1 and CCNE2 were directly regulated by miR-144-5p and might be good prognostic markers for survival of bladder cancer patients
25843294 Results suggest that the miR-30d-5p/CCNE2 axis may contribute to NSCLC cell proliferation and motility.
25550809 Our study shows miR-25 is overexpressed in small cell lung cancer and acting as oncogenic regulator by regulating cyclin E2.
25475054 data suggests the potential role of monomorphic morphology, high cyclin E2 and Ki67 expression as adverse prognostic factors for TNKLPD
24116110 Data indicate that miR-26a overexpression inhibited pancreatic cancer cell growth by the downregulation of cyclin E2 expression.
23324395 Cyclin E2 induction of genomic instability by a mechanism distinct from cyclin E1 indicates that these two proteins have unique functions in a cancer setting.
23324394 In cancer cells Fbw7, fails to effectively target cyclin E2 for proteosomal degradation.
22394640 protein and mRNA expressions of Cyclin E2 in nasopharyngeal carcinoma
21789246 Tamoxifen resistant tumors displayed enriched expression of genes related to cell cycle and proliferation, as well as elevated activity of E2F transcription factors.
19738611 Observational study of gene-disease association. (HuGE Navigator)
19638577 Loss of cyclin D1 in ovarian cancer cells treated with SHetA2 is sufficient to induce G(1) cell cycle arrest and this strategy is not impeded by the presence of cyclin E2.
19603101 Investigated downregulation of coronary vascular smooth muscle cell growth by siRNA against E2F1, cyclins E1 and E2. Data shows reduction in the phosphorylation levels of the retinoblastoma protein pRB and a decrease in the amount of cyclin A2.
19564413 Data indicate that cyclin E2-Cdk2 activation by estrogen occurs via E2F- and CHD8-mediated transcription of cyclin E2 downstream of cyclin D1, and does not require c-myc.
19107233 A hypothetical model whereby PTEN loss upregulates cell cycle genes such as cdc6 and cyclin E2 that in turn promote metastatic colonization at distant sites.
19084516 Since SCF(Fbxw7/hCdc4) is functionally inactivated in several cancer types, alteration of this molecular pathway could contribute to the deregulation of cyclin E2 in tumorigenesis.
16740753 The CCNE2 qualify as independent prognostic markers for lymph node-negative breast cancer patients.
12466974 expression is deregulated in primary breast tumors

AA Sequence

MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRNCWPPVLSGGISPCI      1 - 70
IIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQ     71 - 140
MRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEF    141 - 210
AYVTDGACSEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQLLD    211 - 280
LCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIP    281 - 350
MEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH                    351 - 404
//

Text Mined References (40)

PMID Year Title
26818545 2016 miR-26a regulates mouse hepatocyte proliferation via directly targeting the 3' untranslated region of CCND2 and CCNE2.
26600399 2016 Survivin and cyclin E2 genes expression in a cohort of Egyptian acute leukemia patients: Clinical importance and future prospects.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26265440 2015 A novel HMGA1-CCNE2-YAP axis regulates breast cancer aggressiveness.
26057453 2015 Tumour-suppressive microRNA-144-5p directly targets CCNE1/2 as potential prognostic markers in bladder cancer.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25843294 2015 MicroRNA-30d-5p inhibits tumour cell proliferation and motility by directly targeting CCNE2 in non-small cell lung cancer.
25550809 2014 MicroRNA-25 regulates small cell lung cancer cell development and cell cycle through cyclin E2.
25475054 2014 Prognostic implication of morphology, cyclinE2 and proliferation in EBV-associated T/NK lymphoproliferative disease in non-immunocompromised hosts.
24116110 2013 The loss of miR-26a-mediated post-transcriptional regulation of cyclin E2 in pancreatic cancer cell proliferation and decreased patient survival.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23324395 2013 Cyclin E2 induces genomic instability by mechanisms distinct from cyclin E1.
23324394 2013 Differences in degradation lead to asynchronous expression of cyclin E1 and cyclin E2 in cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22394640 2012 [Expression and clinical significance of cyclin E2 in nasopharyngeal carcinoma].
21789246 2011 An integrated bioinformatics approach identifies elevated cyclin E2 expression and E2F activity as distinct features of tamoxifen resistant breast tumors.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19638577 2009 Cyclin D1 degradation is sufficient to induce G1 cell cycle arrest despite constitutive expression of cyclin E2 in ovarian cancer cells.
19603101 Role of E2F1-cyclin E1-cyclin E2 circuit in human coronary smooth muscle cell proliferation and therapeutic potential of its downregulation by siRNAs.
19564413 2009 Estrogen regulation of cyclin E2 requires cyclin D1 but not c-Myc.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19107233 2009 Cdc6 and cyclin E2 are PTEN-regulated genes associated with human prostate cancer metastasis.
19084516 2009 SCF(Fbxw7/hCdc4) targets cyclin E2 for ubiquitin-dependent proteolysis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16740753 2006 Which cyclin E prevails as prognostic marker for breast cancer? Results from a retrospective study involving 635 lymph node-negative breast cancer patients.
16620772 2006 A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers.
15232106 2004 Self-assembling protein microarrays.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12466974 2002 Deregulation of cyclin E2 expression and associated kinase activity in primary breast tumors.
11907280 2002 Cyclin A- and cyclin E-Cdk complexes shuttle between the nucleus and the cytoplasm.
10454565 1999 Ectopic expression of Cdc25A accelerates the G(1)/S transition and leads to premature activation of cyclin E- and cyclin A-dependent kinases.
9858585 1999 Cyclin E2, a novel G1 cyclin that binds Cdk2 and is aberrantly expressed in human cancers.
9840943 1998 Cyclin E2, a novel human G1 cyclin and activating partner of CDK2 and CDK3, is induced by viral oncoproteins.
9840927 1998 Cyclin E2: a novel CDK2 partner in the late G1 and S phases of the mammalian cell cycle.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
7799941 1995 Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2.
7629134 1995 Both p16 and p21 families of cyclin-dependent kinase (CDK) inhibitors block the phosphorylation of cyclin-dependent kinases by the CDK-activating kinase.