Property Summary

NCBI Gene PubMed Count 271
PubMed Score 239.16
PubTator Score 298.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis 2.500 1.8e-221
osteosarcoma -2.050 2.5e-03
adrenocortical carcinoma 2.003 4.6e-06
non-small cell lung cancer 1.502 9.3e-19
intraductal papillary-mucinous neoplasm ... 1.500 4.2e-03
lung cancer 1.800 1.6e-04
lung adenocarcinoma 1.600 3.3e-06
Breast cancer 1.400 1.4e-08
ovarian cancer 2.600 8.6e-08

Protein-protein Interaction (5)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (205)

PMID Text
26677902 Clioquinol suppressed cell cycle progression in the S-phase in SMMC-7721 hepatoma cells via the p21, p27-cyclin E,A/Cdk2 pathway.
26647729 The effects of CCNE1 knockdown were dependent on the CCNE1 expression status.
26625764 The findings suggest that the role of cyclin E and tumor specific low molecular weight isoforms as mediators of tumorigenesis is in part dependent on p53 context.
26540345 Data show that melanoma antigen, family C, 2 protein (MAGE-C2) binds with RING-box protein 1 (Rbx1) and Cullin 1, and regulates cyclin E stability in melanoma cells.
26475304 Ad-cycE can target cyclin E overexpression in cancer cells and repress tumor growth in syngeneic mouse models.
26344002 Both fenhexamid and cyprodinil may increase cancer cell proliferation by stimulating the protein expressions of cyclin D1 and cyclin E.
26219338 our findings identify a novel mechanism of cyclin E-mediated Mcl-1 regulation in human cancer
26204491 ovary tumors with elevated CCNE1 expression may be staged for Cdk2-targeted therapy
26057453 miR-144-5p functions as tumour suppressor in BC cells. CCNE1 and CCNE2 were directly regulated by miR-144-5p and might be good prognostic markers for survival of bladder cancer patients
26026100 Contrary to previous literature, we found a correlation between cyclin E expression and prognosis. Further large-scale studies are required to confirm our findings.
26007664 miR-15b might be involved in termination of osteoblastic cells proliferation by arresting them at G0/G1 phase through direct targeting cyclin E1.
25959964 A significant correlation between cyclin E1 amplification and deletions at a number of the genomic loci in breast cancer.
25909221 These results indicate cyclin E1 is downregulated by both miR-497 and miR-34a, which synergistically retard the growth of human lung cancer cells.
25892415 Results show that CCNE1 and BRD4 on chromosome 19 were amplified/overexpressed in a substantial cases of epithelial ovarian cancer with no involvement of BRCA genes.
25830480 Results show that miR-16 and HuR co-regulate the cyclin E1 mRNA without influencing each other's binding or expression. miR-16 regulation predominates, blocking upregulation of cyclin E1 by HuR.
25744732 Diclofenac and curcumin overcome these carcinogenic effects by downregulating telomerase activity, diminishing the expression of TERT, CDK4, CDK2, cyclin D1, and cyclin E.
25732226 MicroRNA-30c-2-3p negatively regulates NF-kappaB signaling and cell cycle progression through downregulation of TRADD and CCNE1 in breast cancer.
25627202 High levels of cyclin E are a predicator of poor prognosis among patients with gastrointestinal cancer. [meta-analysis]
25527175 High Cyclin E1 expression is associated with epithelial ovarian cancer.
25501982 HOXA7 promotes cell proliferation, and these changes are mediated by cyclin E1/CDK2
25463638 This study indicates that genetic polymorphisms of AURKA, BRCA1 and CCNE1 may contribute to endometrial carcinoma susceptibility or progression in Chinese Han women.
25408144 Global gene expression profiling identifies ALDH2, CCNE1 and SMAD3 as potential prognostic markers in upper tract urothelial carcinoma.
25399696 Suppression of NF90 caused a decrease in the half-life of cyclin E1 mRNA
25320178 CCNE1 variants are associated with bladder cancer aggressiveness.
25310086 The cell cycleassociated proteins cyclin E and p27kip1 may have contributed to this antitumor effect.
25289861 Aurora-A/HURP relays cell transforming signal to NF-kappaB, and the HURP/NF-kappaB complex is engaged in the regulation of cyclin E1 expression.
25159285 This study indicates that CCNE1 rs1406 polymorphism may contribute to BC risk
25131797 conclude that p21/cyclin E pathway is crucial in modulating the anticlastogenic function of Bmi-1
24947816 More effective packing and interactions between CDK2 and LMW cyclin E isoforms, however, produce more efficient protein-protein complexes that accelerate the cell division processes in cancer cells, where these cyclin E isoforms are overexpressed.
24909281 Data indicate that over-expressed miR-497 in HeLa cells could suppress cell proliferation by targeting cyclin E (CCNE1).
24742107 CCNE1 gene amplification was found in 19% of esophageal adenocarcinomas, but no Barrett's esophagus. Increased cyclin E expression was found in 16.7% of EAC, 35.7% in high grade dysplasia, 19.0% in low grade dysplasia, and 5.8% in Barrett's esophagus.
24671051 Expression of Notch1, -2, and -3, CDK2, and CCNE1 was significantly decreased by upregulation of ALDH1A1 in A549 cells, but increased by its interruption in A549s cells.
24509904 PP2A-B55beta promotes cyclin E1 overexpression by antagonizing its degradation and its inhibition could represent a therapeutic mechanism for abrogating cyclin E1 function in cancers
24449507 miR-132 functions as a tumor suppressor in osteosarcoma and that its suppressive effects are mediated chiefly by repressing CCNE1 expression.
24370822 miR-7 exerts tumor-suppressive effects in hepatocarcinogenesis through the suppression of oncogene CCNE1 expression.
24366882 Cyclin E1 dysregulation acts to drive malignant transformation in fallopian tube secretory cells that are the site of origin of high-grade serous ovarian carcinomas.
24309323 Amplification of CCNE1 is a frequent molecular genetic change in uterine serous carcinoma. The identification of CCNE1 amplification in many endometrial intraepithelial carcinomas suggests that this genetic event occurs early during tumor progression.
24218601 Synthetic lethality between CCNE1 amplification and loss of BRCA1.
24176298 High CCNE1 gene expression is a significant and independent predictor for prolonged overall survival in FIGO III/IV EOC patients.
24145166 Reveal a novel role for a RhoBTB3 in catalyzing cyclin E turnover during S phase, as well as an unexpected, essential role for the Golgi as a ubiquitylation platform for cell cycle control.
24026986 presence of cyclin E isoforms in p53 silenced clones also does not altered HER-2 expression
24004674 Resistance to CDK2 inhibitors is associated with selection of polyploid cells in CCNE1-amplified ovarian cancer.
23955388 Low-molecular weight cyclin E is associated with breast cancer .
23900874 The results indicate that high cyclin E1 expression may have prognostic importance in neuroblastic tumors in children.
23900351 the upregulation of miR-15a expression causes cellular growth inhibition, suppression of migration and G1 phase arrest by targeting CCNE1
23815208 elevated in endometrial cancer samples
23787073 This study indicates that genetic polymorphisms of AURKA, BRCA1 and CCNE1 may affect ovarian cancer susceptibility in Chinese Han women.
23775012 Studies indicate that cyclin E overexpression is associated with poor overall survival (OS) and breast cancer-specific survival (BCSS) in breast cancer.
23625206 Data indicate that estrogen induced the expression of c-Jun, Fra-1, c-Fos, cyclin D1 and cyclin E1 while tamoxifen (TMX) decreased the expression.
23543735 GCN5 has a role in potentiating growth of non-small cell lung cancer by promoting E2F1, cyclin D1, and cyclin E1 expression
23416081 these data demonstrate that CCNE1 rs3218073 polymorphism located at miRNA-151 binding site is associated with nasopharyngeal carcinoma (NPC) susceptibility and is correlated with NPC stage.
23383003 miR-195 plays an important role to inhibit the proliferation of glioma cells, and present a novel mechanism for direct miRNA-mediated suppression of cyclin D1 and cyclin E1 in glioma
23378270 Rsf-1 interacts and collaborates with cyclin E1 in neoplastic transformation and TP53 mutations are a prerequisite for tumour-promoting functions of the RSF/cyclin E1 complex.
23324395 Cyclin E2 induction of genomic instability by a mechanism distinct from cyclin E1 indicates that these two proteins have unique functions in a cancer setting.
23314229 Triptolide induces S phase arrest via the promotion of p21 and p27 and the inhibition of cyclin A and CDC25A expression.
23185313 This study aimed to explore the effects of single nucleotide polymorphisms in CDK2 and CCNE1 on breast cancer risk, progression and survival in a Chinese Han population.
23044415 HPV infection is strongly associated with the pathogenesis of BP, and HPV may be involved in the regulation of the expression of cell cycle related proteins, cyclin D1 and cyclin E, in the pathogenesis of Bowenoid papulosis.
22958293 Sixty-two per cent of the ovarian cancers were positive for cyclin E expression with the highest percentage found in clear cell carcinomas.
22945645 Cyclin E-induced replication stress is caused by deregulation of replication initiation
22763964 These findings indicate the possible involvement of cyclins A and E in the pathogenesis of malignant melanoma.
22763761 No significant correlation was found between p-27, Cyclin D3, and cyclin E in pediatric Embryonal tumors
22558078 CCNE1 silencing with siRNA increases multiple myeloma cell sensitivity to seliciclib.
22484283 MIC-1-induced expression of cyclins D1 and E was mediated by AP-1 and E2F-1 transcription factors, and among the AP-1 members, c-Jun and JunD appeared to participate in MIC-1-dependent transcription of the cyclin D1 gene.
22460364 Slow progression into S-phase in gamma-tocopherol treated prostate cancer cells is marked by increased TG2 expression and decreased CyclinsE and D1.
22449977 Results show that estrogen may contribute to both up-regulation and proteolysis of cyclin E through calpain in MCF-7 cells.
22441703 overexpression of low molecular weight (LMW) cyclin E and increased cyclin E kinase activity were associated with tumorigenicity of bladder cell lines; full-length and LMW cyclin E were overexpressed in grade 3 bladder tumors compared with grade 2; LMW cyclin E levels were associated with non-papillary growth pattern and invasiveness of tumors and poor survival
22120721 report that BMI1 has a critical role in stabilizing cyclin E1 by repressing the expression of FBXW7, a substrate-recognition subunit of the SCF E3 ubiquitin ligase that targets cyclin E1 for degradation
21941773 DNA-PK might play a role in silica-induced alternations of cell cycle and regulate silica-induced overexpression of CyclinE in human embryo lung fibroblasts.
21918011 Epstein-Barr virus Rta-mediated transactivation of p21 and 14-3-3sigma arrests cells at the G1/S transition by reducing cyclin E/CDK2 activity.
21792910 IFN-beta down-regulates cyclin E1 and up-regulates p21 mRNA levels in hepatic stellate cell line LX-2.
21750416 cAMP induces autophagy via a novel pathway involving ERK, cyclin E and Beclin 1
21746877 our fi ndings reveal a direct link between cyclin E and HIF-1 activities in mammary epithelial cells and implicate HIF-1 as a mediator of proliferation-independent phenotypes associated with high cyclin E expression in some human breast cancers.
21597324 Data demonstrate that attenuation of FBW7 by miR-27a overexpression leads to improper cell cycle progression and DNA replication stress, consistent with dysregulation of cyclin E expression.
21515670 cyclin E and CDK2 genes are key physiological effectors of the c-ETS1 proto-oncogene. Furthermore, c-ETS1 is indispensable for the hepatotropic action of HBx in cell cycle deregulation.
21472690 cyclin A was strongly associated with the expression of cyclin E in invasive ductal breast carcinoma
21464733 that the overexpression of p16 and Cyclin E are valuable factors predicting disease progression and metastatic potential of ovarian carcinoma
21458381 Overexpression of cyclin E1 in osteosarcoma has potential prognostic and therapeutic implications.
21315112 This study is the first to demonstrate that K(+) channels such as hEag1 are directly involved in the IGF-1-induced up-regulation of cyclin D1 and E expression in MCF-7 cells.
21179471 decreased mir-424 expression and increased levels of MEK1 or cyclin E1 in senile hemangioma may cause abnormal cell proliferation in the tumor
21150326 Data show that cyclin E-mediated inhibition of Smad3 is regulated by CDK2 phosphorylation of the Smad3 protein in MCF7 cells.
21103391 Observations have implications for the application of targeted therapies in CCNE1 dependent ovarian cancers.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20972438 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20837705 Results indicate that DDX3 is critical for translation of cyclin E1 mRNA, which provides an alternative mechanism for regulating cyclin E1 expression during the cell cycle.
20607601 cyclin E1 is repressed independent of effects on cyclin D1 in a 3D collagen environment and dependent on beta1 integrin interaction with collagen I, reducing proliferation of invasive breast cancer cells.
20530685 Low molecular weight cyclin E overexpression shortens mitosis, leading to chromosome missegregation and centrosome amplification in breast cancer.
20530684 Cyclin E deregulation impairs mitotic progression through premature activation of Cdc25C in breast cancer.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20465575 In addition to having a pivotal role in the up-regulation of IL-2 and IL-2RA gene expression, IKK controls the expression of cyclin D3, cyclin E and CDK2, and the stability SKP2 and its co-factor CKS1B, through mechanisms independent of IL-2.
20453888 HER2-mediated signaling effects low molecular weight cyclin E expression, which in turn deregulates the cell cycle.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20385564 p65 negatively regulates transcription of the cyclin E gene
20336784 CCNE1 overexpression is critical to growth and survival of ovarian cancer tumors with CCNE1 gene amplification.
20171175 RPL6 was overexpressed in human gastric cancer and its over-expression could promote cell growth and cell cycle progression at least through upregulating cyclin E expression.
20107311 Gene knockdown of cyclin E had substantial consequences leading to G(1)-phase arrest and inhibition of proliferation.
20102401 cyclin E, may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma
20001501 A high expression of cyclin E in tumor was associated with an increased risk of tumor recurrence and a worse outcome
19925052 Studies illustrated tools for cut-off level determination with prognostic tumor-related biomarkers Bcl-2, Bcl-6, CD10, FOXP1, MUM1, and Cyclin E in DLBCL.
19860623 increase in CDK6, Cyclin E, p27kip1, and p21waf1 expression, and after 6BIO treatment, the expression of most of these proteins decreased.
19801544 Data show that RNA interference silencing of CUL4B led to an inhibition of cell proliferation and a prolonged S phase, due to the overaccumulation of cyclin E.
19787784 findings indicate that SOX2 and CCNE1 might be activated via gene copy number gain and participate in oral carcinogenesis
19738611 Observational study of gene-disease association. (HuGE Navigator)
19724860 Overexpression of Notch1 in laryngeal carcinoma cell line was coupled with the downregulation of cyclin E
19713765 p53 affects S phase progression following UV exposure by preventing the sustained unscheduled expression of cyclin E
19670700 Intensive immunoreactivity of cyclin E in glandular cells is typical for endometrial hyperplasia.
19621596 There was no significant difference in expression of cyclin E in laryngeal squamous cell carcinoma, dysplastic squamous epithelium, or vocal cord polyps.
19617534 These findings suggest a hyperfused mitochondrial system with specialized properties at G(1)-S is linked to cyclin E buildup for regulation of G(1)-to-S progression.
19615252 Inhibition of cyclin E expression in breast cancer cells can block their cell cycle at G(1) phase, reduce their cell growth, differentiation and proliferation, and increase their sensitivity to chemotherapy.
19603101 Investigated downregulation of coronary vascular smooth muscle cell growth by siRNA against E2F1, cyclins E1 and E2. Data shows reduction in the phosphorylation levels of the retinoblastoma protein pRB and a decrease in the amount of cyclin A2.
19587092 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19585504 Tumor-specific expression of alternatively spliced Parkin isoforms might contribute to enhanced cell proliferation through the attenuation of proteolysis-mediated cyclin E regulation in human colorectal cancers.
19574535 There is increased expression of cyclins D1, D2, and E1 associated with increased gli2 levels.
19569046 CCNE1 is upregulated in primary gastric cancer.
19561641 Post-translational modification and stability of low molecular weight cyclin E are reported.
19505905 overexpressed cyclin B1, veiling the effect of cyclin D1 or cyclin E, mediated nickel-caused M-phase blockage and cell growth inhibition, which may render pulmonary cells more sensitive to DNA damage and facilitates cancer initiation
19470724 Cyclins B1, D1, and E1 have distinct expressions in different breast cancer subtypes.
19454496 CCNE1 is a novel IGH translocation partner in t(14;19)(q32;q12) in diffuse large B-cell lymphoma
19423708 recovery from the S phase checkpoint in that in response to replication stress phosphorylation of Artemis by ATR enhances its interaction with Fbw7, which in turn promotes ubiquitylation and the ultimate degradation of cyclin E
19321444 The combination of st and deregulated cyclin E result in cooperative and coordinated activation of both an essential origin licensing factor, CDC6, and an activity required for origin firing, CDK2, resulting in progression from quiescence to S phase.
19305161 The LMW isoforms of cyclin E are tumor specific, and are biochemically and biologically distinct from the full-length cyclin E which could provide a novel role in breast cancer progression.
19258477 Strengthened signals in imputation-based analysis at CCNE1 SNP rs3218036 lends evidence to the role of cell cycle genes in ovarian cancer etiology.
19258477 Observational study of gene-disease association. (HuGE Navigator)
19236751 After treating of NB4 cells with As(2)O(3), P27(Kip1) and endogenous TGF-beta1 mRNA expressions were up-regulated, and cyclin E mRNA expression was down-regulated.
19179977 A high expression of cyclin E measured by immunohistochemistry was a significant factor of poor prognosis, especially in the node-positive group.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19107593 Overexpression of cyclin E is associated with breast cancer invasiveness
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19058005 Expression of cyclin E could not predict survival in patients with gastric cancer, whereas the expression of pRb and p21 was associated with a favorable prognosis.
19010853 Loss of p27 and overexpression of cyclin E play a critical role in the aggressiveness of gastroenteropancreatic neuroendocrine tumors
18959818 RNA and protein levels of cyclin E1, a dominant oncoprotein, were elevated in the EBP2- enhanced green fluorescent protein stable clones.
18799789 Cyclin E is shown to directly interact with and colocalize on centrosomes with the DNA replication factor MCM5 in a centrosomal localization sequence-dependent but Cdk2-independent manner.
18799628 Results suggest that cyclin E plays an important, cdk2-independent role in genotoxic stress-induced apoptosis in mesenchymal stem cells.
18651214 Down regulation of functional Per2 gene expression increases Cyclin D and Cyclin E levels
18607847 Aberrant expression of cyclin E is not associated with low-risk node negative breast cancer.
18507837 Observational study of gene-disease association. (HuGE Navigator)
18455747 The V3 loop of HIV-1 gp120 induces G1 arrest in IL-2-dependent cell cycle progression by reducing cyclin E expression and phosphorylation of retinoblastoma protein (pRb)
18381935 Cyclin E and cyclin D1 expression distinguishes non-BRCA1/2 tumors from both sporadic and BRCA1- and BRCA2-associated tumors and may reflect different predisposition and pathogenesis in these groups.
18344087 Rectal cancer patients with low cyclin E expression and negative blood vessel invasion had a significantly better prognosis than those with high cyclin E expression and positive BVI.
18301453 Immunohistochemical tests for p16 (INK4A) and cyclin E could help in early diagnosis of cervical carcinoma.
18281541 Observational study of gene-disease association. (HuGE Navigator)
18276582 Cyclin E and SV40 small T antigen cooperate to bypass quiescence and contribute to transformation by activating CDK2 in human fibroblasts
18208561 growth arrest by SmE directly correlates with the reduction of cyclin E, CDK2, CDC25C and CDC2 expression, and up-regulation of p27Kip
18174243 Observational study of gene-disease association. (HuGE Navigator)
18047954 Tissue expression of cyclin D1 or E1 seems not to add independent prognostic value to standard features in patients with nonmuscle -invasive urothelial cell carcinoma of the bladder.
17822621 Up-regulation of cyclin E protein may represent one of the possible mechanisms for centrosome amplification in squamous cell carcinoma of oral cavity.
17726548 The overexpression of cyclin E positively correlated with the decreasing degree of tumor differentiation, implicating a role for cyclin E in the promotion of tumorigenesis.
17664332 Data show that cyclin E overexpression impairs progression through mitosis by inhibiting APC(Cdh1).
17661632 The V3 loop of HIV-1 gp120 induces G1 arrest in IL-2-dependent cell cycle progression by reducing cyclin E expression and phosphorylation of retinoblastoma protein (pRb)
17409409 Observational study of gene-disease association. (HuGE Navigator)
17360482 cyclin E has a role in dysplasia and multiple pulmonary adenocarcinomas
17325036 Association of a fragment of cyclin E with Ku70 induces dissociation of Bax, its activation, and apoptosis. These interactions provide a balance between apoptosis and the survival of cells exposed to genotoxic stress.
17218276 This work indicates that-in addition to their function as CDK activators-E cyclins play kinase-independent functions in cell-cycle progression.
16912169 HuR critically contributes to cyclin E1 overexpression and its growth-promoting function in breast cancer cells.
16823179 Gene amplification of cyclin E affects the correlation between gene amplification and protein expression of cyclin A, as well as the prognostic value of cyclin A overexpression.
16799991 an isoform of cyclin E1 involved in G0 maintenance and suggest an additional mechanism for cell cycle control.
16761619 cyclin E expression in breast cancer cells is associated with negative steroid receptor status, HER2 presence, higher tumor grade and higher proliferation index
16740753 The CCNE1 qualify as independent prognostic markers for lymph node-negative breast cancer patients, and CCNE1 may provide additional information for specific subgroups of patients.
16609025 The CCNE expression assessment is easy on paraffin-embedded tissue and high CCNE expression hints at the presence of a possible target for individualized cancer therapy.
16538501 Higher cyclin E expression in samples of ZAP 70-positive patients may reflect a larger proliferating compartment in vivo compared to ZAP 70-negative patients with B-cell chronic leukemia.
16504183 Cyclin-dependent kinases regulate the transcriptional activity of FOXM1c; a combination of three phosphorylation sites mediates the Cyclin E and Cyclin A/CDK2 effects.
16391523 These findings suggested that cyclin E may play a role in suppressing the colony formation of CFU-GM by CKbeta8-1.
16322693 human CUL4B and cyclin E proteins interact with each other and the CUL4B complexes can polyubiquitinate the CUL4B-associated cyclin E
16289656 The V3 loop of HIV-1 gp120 induces G1 arrest in IL-2-dependent cell cycle progression by reducing cyclin E expression and phosphorylation of retinoblastoma protein (pRb)
16191374 The genesis and invasion of ameloblastoma is associated with the cell proliferation and differentiation, and regulated by the higher expression of cyclin E and the lower expression of p21(WAF1) and p27(KIP1).
16124066 The decreased expression of p57(kip2) and/or overexpression of cyclinE protein and PCNA may contribute to the occurrence and progression of pancreatic cancer.
15800668 p16(INK4A) reconstitution in p16(INK4A)-deficient T-ALL cells induced cell cycle arrest in the presence of cyclin E and c-Myc expression, uncoupled growth from cell cycle progression and caused a sequential process of growth, differentiation and apoptosis
15709169 Cyclin E expression may be characteristic for papillary thyroid carcinomas with a tendency to early metastasizing.
15708847 low molecular weight forms of cyclin E may contribute to tumorigenesis through their resistance to the inhibitory activities of p21 and p27 while sequestering these CKIs from the full-length cyclin E
15665273 overexpressed in breast cancer development.
15660127 crystal structure of phospho-CDK2 in complex with a truncated cyclin E1 (residues 81-363) at 2.25 A resolution
15611651 We propose that such increased E2F activity stabilizes cyclin E and contributes to establish the high and persistent levels of the protein commonly found in human neoplasias.
15557791 Cyclin E expression is significantly higher in clear cell than in serous ovarian carcinomas. Cyclin E expression is significantly related with p53 positivity.
15467469 Our results demonstrate a physiologic role for TRIP-Br in coupling E2F to novel functions in the regulation of cyclin E expression during cell cycle progression to ensure the proper execution of DNA replication and the maintenance of genomic stability.
15343382 The V3 loop of HIV-1 gp120 induces G1 arrest in IL-2-dependent cell cycle progression by reducing cyclin E expression and phosphorylation of retinoblastoma protein (pRb)
15197178 Cyclin E-mediated impairment of DNA replication provides a potential mechanism for chromosome instability observed as a consequence of cyclin E deregulation.
15191351 study shows that cyclin E overproduction is of adverse prognostic significance in adrenocortical tumors
15060836 The expression patterns of cyclin D1, cyclin E, p21/waf1 and p27/kip1 in inflammatory bowel disease (IBD) may indicate their contribution in epithelial cell turnover and their possible implication in IBD-related dysplasia-carcinoma.
15007381 Cyclin E low molecular weight forms have roles in ovarian tumorigenesis
14965268 This review summarizes what is known about the biological role of cyclin E1 and cyclin E2, their deregulation in cancer, and the opportunities they may provide as targets in clinical therapy.
14719078 Assessment of p21, p27, Bax, and cyclin E expression in tumor tissues have been reported to be useful as prognostic factors in head and neck squamous cell carcinoma.
14645251 CDK2-cyclin E, without prior CDK4-cyclin D activity, can phosphorylate and inactivate pRb, activate E2F, and induce DNA synthesis.
14612403 p220 is an essential downstream component of the cyclin E/Cdk2 signaling pathway and functions to coordinate multiple elements of the G1/S transition.
12824885 Up-regulation of cyclin E is associated with spindle-cell sarcoma
12778072 High levels of this protein are found in malignant glioma.
12777997 results show that cyclin D2 is complexed with p27, leading to a model for testicular germ cell tumors whereby the overexpression of cyclin D2 leads to the functional sequestration of p27 in the presence of CCNE and CCND2, favoring cell proliferation
12729791 Data suggest that the interaction between PKCeta and cyclin E is carefully regulated, and is correlated with the inactivated form of the cyclin E/Cdk2 complex.
12647795 overexpression of cyclin D3 and cyclin E was mutually exclusive possibly reflecting different underlying pathways inducing deregulated expression of these cyclins
12601350 increases of cyclin D1, cyclin-dependent kinase 4, cyclin E, cyclin A, and Wee1 play an important role in the development of hepatocellular carcinoma from cirrhosis
12553912 A 2.7 A X-ray crystal structure of a Skp1-Cdc4 complex bound to a high-affinity CPD phosphopeptide from human cyclin E reveals a core CPD motif, Leu-Leu-pThr-Pro, bound to an eight-bladed WD40 propeller domain in Cdc4
12533700 human cytomegalovirus immediate-early protein 2 can activate cyclin E independent of the cell-cycle state
12444551 CDK-independent transactivation of the estrogen receptor by cyclin D1 is, by itself, not sufficient to cause estradiol-independent growth of breast cancer cells. A vast overexpression of G1/S cyclins D1 A & E is able to do so by capturing CDK inhibitors.
12133429 function and clinical value of cyclin E and p27 in adult acute leukemia (AL)
12114499 The V3 loop of HIV-1 gp120 induces G1 arrest in IL-2-dependent cell cycle progression by reducing cyclin E expression and phosphorylation of retinoblastoma protein (pRb)
12101670 regulates cell cycle
12096344 The cyclin D1 high and cyclin E high subgroups of breast cancer: separate pathways in tumorogenesis based on pattern of genetic aberrations and inactivation of the pRb node.
12096339 Ectopic expression of cyclin E in estrogen responsive cells abrogates antiestrogen mediated growth arrest.
11919196 Cyclin E is a target of WT1 transcriptional repression
11907280 found that cyclin A and cyclin E are able to regulate both nuclear and cytoplasmic events because they both shuttle between the nucleus and the cytoplasm
11884622 Proteolytic cleavage of cyclin E leads to inactivation of associated kinase activity and amplification of apoptosis in hematopoietic cells
11877298 Retinoic acid-induced cell cycle arrest of human myeloid cell lines is associated with sequential down-regulation of c-Myc and cyclin E.
11838966 TSG101 expression in gynecological tumors: relationship to cyclin D1, cyclin E, p53 and p16 proteins.
10851086 This study identifies cyclin E1 as a target for activation by ionizing radiation and which plays a functional role in apoptosis of hematopoietic cells. Run-on analyses indicated a predominantly transcriptional regulation of cyclin E.
9525916 The V3 loop of HIV-1 gp120 induces G1 arrest in IL-2-dependent cell cycle progression by reducing cyclin E expression and phosphorylation of retinoblastoma protein (pRb)
9453249 The V3 loop of HIV-1 gp120 induces G1 arrest in IL-2-dependent cell cycle progression by reducing cyclin E expression and phosphorylation of retinoblastoma protein (pRb)
9223324 The V3 loop of HIV-1 gp120 induces G1 arrest in IL-2-dependent cell cycle progression by reducing cyclin E expression and phosphorylation of retinoblastoma protein (pRb)

AA Sequence

MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVTVFLQDPDEEMAKIDRTARDQCGSQPWDNNAVCAD      1 - 70
PCSLIPTPDKEDDDRVYPNSTCKPRIIAPSRGSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLL     71 - 140
QPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKL    141 - 210
HQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAE    211 - 280
LLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFR    281 - 350
GVADEDAHNIQTHRDSLDLLDKARAKKAMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA              351 - 410
//

Text Mined References (276)

PMID Year Title
26677902 2015 Induction of cell cycle arrest via the p21, p27-cyclin E,A/Cdk2 pathway in SMMC-7721 hepatoma cells by clioquinol.
26647729 2016 CCNE1 amplification is associated with aggressive potential in endometrioid endometrial carcinomas.
26625764 2015 Overexpression of Cyclin E and its Low Molecular Weight Isoforms Cooperate with Loss of p53 in Promoting Oncogenic Properties of MCF-7 Breast Cancer Cells.
26540345 2015 Cancer-testis antigen MAGE-C2 binds Rbx1 and inhibits ubiquitin ligase-mediated turnover of cyclin E.
26475304 2015 Oncolytic adenovirus targeting cyclin E overexpression repressed tumor growth in syngeneic immunocompetent mice.
26344002 2015 Effect of fenhexamid and cyprodinil on the expression of cell cycle- and metastasis-related genes via an estrogen receptor-dependent pathway in cellular and xenografted ovarian cancer models.
26219338 2015 Cyclin E/Cdk2-dependent phosphorylation of Mcl-1 determines its stability and cellular sensitivity to BH3 mimetics.
26204491 2015 Cyclin-dependent kinase 2 is an ideal target for ovary tumors with elevated cyclin E1 expression.
26057453 2015 Tumour-suppressive microRNA-144-5p directly targets CCNE1/2 as potential prognostic markers in bladder cancer.
26026100 2015 Cyclin E Expression Correlates with Cancer-specific Survival in Endometrial Endometrioid Adenocarcinoma.
26007664 2015 Regulation of proliferation and apoptosis in human osteoblastic cells by microRNA-15b.
26004630 2015 Transcriptome Signature and Regulation in Human Somatic Cell Reprogramming.
25959964 2015 Cyclin E deregulation promotes loss of specific genomic regions.
25909221 2015 miR-497 and miR-34a retard lung cancer growth by co-inhibiting cyclin E1 (CCNE1).
25892415 2015 Histo-genomic stratification reveals the frequent amplification/overexpression of CCNE1 and BRD4 genes in non-BRCAness high grade ovarian carcinoma.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25830480 2015 MicroRNA-16 modulates HuR regulation of cyclin E1 in breast cancer cells.
25744732 2015 Downregulation of telomerase activity by diclofenac and curcumin is associated with cell cycle arrest and induction of apoptosis in colon cancer.
25732226 2015 MicroRNA-30c-2-3p negatively regulates NF-?B signaling and cell cycle progression through downregulation of TRADD and CCNE1 in breast cancer.
25627202 2016 Prognostic Value of Expression of Cyclin E in Gastrointestinal Cancer: A Systematic Review and Meta-Analysis.
25527175 2015 Characterization of the 19q12 amplification including CCNE1 and URI in different epithelial ovarian cancer subtypes.
25501982 2015 HOXA7 stimulates human hepatocellular carcinoma proliferation through cyclin E1/CDK2.
25463638 2015 Association of genetic polymorphisms in AURKA, BRCA1, CCNE1 and CDK2 with the risk of endometrial carcinoma and clinicopathological parameters among Chinese Han women.
25408144 2014 Global gene expression profiling identifies ALDH2, CCNE1 and SMAD3 as potential prognostic markers in upper tract urothelial carcinoma.
25399696 2015 Regulation of cell cycle of hepatocellular carcinoma by NF90 through modulation of cyclin E1 mRNA stability.
25320178 2014 The 19q12 bladder cancer GWAS signal: association with cyclin E function and aggressive disease.
25310086 2014 14-3-3? functions as an oncogene in SGC7901 gastric cancer cells through involvement of cyclin E and p27kip1.
25289861 2015 The involvement of nuclear factor-?appaB in the nuclear targeting and cyclin E1 upregulating activities of hepatoma upregulated protein.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25159285 2014 Association between CCNE1 polymorphisms and the risk of breast cancer in a sample of southeast Iranian population.
25131797 2015 p21/Cyclin E pathway modulates anticlastogenic function of Bmi-1 in cancer cells.
24947816 2014 Why are the truncated cyclin Es more effective CDK2 activators than the full-length isoforms?
24909281 2014 [miR-497 suppresses proliferation of human cervical carcinoma HeLa cells by targeting cyclin E1].
24742107 2014 Cyclin E involved in early stage carcinogenesis of esophageal adenocarcinoma by SNP DNA microarray and immunohistochemical studies.
24671051 2014 ALDH maintains the stemness of lung adenoma stem cells by suppressing the Notch/CDK2/CCNE pathway.
24509904 2014 PP2A-B55? antagonizes cyclin E1 proteolysis and promotes its dysregulation in cancer.
24449507 2014 miR-132 targeting cyclin E1 suppresses cell proliferation in osteosarcoma cells.
24370822 2014 MicroRNA-7 arrests cell cycle in G1 phase by directly targeting CCNE1 in human hepatocellular carcinoma cells.
24366882 2014 Cyclin E1 deregulation occurs early in secretory cell transformation to promote formation of fallopian tube-derived high-grade serous ovarian cancers.
24309323 2014 Frequent CCNE1 amplification in endometrial intraepithelial carcinoma and uterine serous carcinoma.
24218601 2013 Synthetic lethality between CCNE1 amplification and loss of BRCA1.
24176298 2014 Cyclin E1 (CCNE1) as independent positive prognostic factor in advanced stage serous ovarian cancer patients - a study of the OVCAD consortium.
24163127 2014 Genome-wide association study identifies multiple loci associated with bladder cancer risk.
24145166 2013 Golgi-associated RhoBTB3 targets cyclin E for ubiquitylation and promotes cell cycle progression.
24026986 2013 P53 but not cyclin E acts in a negative regulatory loop to control HER-2 expression in MCF-7 breast carcinoma cell line.
24004674 2013 Resistance to CDK2 inhibitors is associated with selection of polyploid cells in CCNE1-amplified ovarian cancer.
23955388 2013 Hbo1 is a cyclin E/CDK2 substrate that enriches breast cancer stem-like cells.
23900874 2013 Prognostic importance of cyclin E1 expression in neuroblastic tumors in children.
23900351 2013 MiR-15a is underexpressed and inhibits the cell cycle by targeting CCNE1 in breast cancer.
23853094 2013 Foxp3 protein stability is regulated by cyclin-dependent kinase 2.
23815208 2013 Expression of cyclin A, cyclin E and p27 in normal, hyperplastic and frankly malignant endometrial samples.
23787073 2013 Genetic polymorphisms in AURKA, BRCA1, CCNE1 and CDK2 are associated with ovarian cancer susceptibility among Chinese Han women.
23775012 2013 Prognostic value of cyclin E expression in breast cancer: a meta-analysis.
23625206 2013 Effect of estrogen and tamoxifen on the expression pattern of AP-1 factors in MCF-7 cells: role of c-Jun, c-Fos, and Fra-1 in cell cycle regulation.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23543735 2013 Lysine acetyltransferase GCN5 potentiates the growth of non-small cell lung cancer via promotion of E2F1, cyclin D1, and cyclin E1 expression.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23416081 2013 A miR-151 binding site polymorphism in the 3'-untranslated region of the cyclin E1 gene associated with nasopharyngeal carcinoma.
23383003 2013 MicroRNA-195 inhibits the proliferation of human glioma cells by directly targeting cyclin D1 and cyclin E1.
23378270 2013 Rsf-1, a chromatin remodelling protein, interacts with cyclin E1 and promotes tumour development.
23324395 2013 Cyclin E2 induces genomic instability by mechanisms distinct from cyclin E1.
23314229 2013 Triptolide induces S phase arrest via the inhibition of cyclin E and CDC25A and triggers apoptosis via caspase- and mitochondrial-dependent signaling pathways in A375.S2 human melanoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23185313 2012 Association of germline variation in CCNE1 and CDK2 with breast cancer risk, progression and survival among Chinese Han women.
23044415 2013 Expression of cyclin D1 and cyclin E significantly associates with human papillomavirus subtypes in Bowenoid papulosis.
22958293 2012 Limited prognostic value of tissue protein expression levels of cyclin E in Danish ovarian cancer patients: from the Danish 'MALOVA' ovarian cancer study.
22945645 2013 Increased replication initiation and conflicts with transcription underlie Cyclin E-induced replication stress.
22763964 2012 Expression of cyclins A and E in melanocytic skin lesions and its correlation with some clinicopathologic features.
22763761 2012 Immunohistochemical expression of cell-cycle regulators in pediatric embryonal brain tumors.
22558078 2012 Characterization of cyclin E expression in multiple myeloma and its functional role in seliciclib-induced apoptotic cell death.
22484283 2012 Macrophage inhibitory cytokine-1 stimulates proliferation of human umbilical vein endothelial cells by up-regulating cyclins D1 and E through the PI3K/Akt-, ERK-, and JNK-dependent AP-1 and E2F activation signaling pathways.
22460364 2013 ?-Tocopherol inhibits human prostate cancer cell proliferation by up-regulation of transglutaminase 2 and down-regulation of cyclins.
22449977 2012 17beta-estradiol induces both up-regulation and processing of cyclin E in a calpain-dependent manner in MCF-7 breast cancer cells.
22441703 2012 Low molecular weight cyclin E is associated with p27-resistant, high-grade, high-stage and invasive bladder cancer.
22120721 2012 Cyclin E1 is a common target of BMI1 and MYCN and a prognostic marker for neuroblastoma progression.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21952639 2011 NIRF constitutes a nodal point in the cell cycle network and is a candidate tumor suppressor.
21941773 2011 [Roles of DNA dependent protein kinase in silica-induced cyclin E and CDK2 expressions and cell cycle changes in human embryo lung fibroblasts].
21918011 2012 Epstein-Barr virus Rta-mediated transactivation of p21 and 14-3-3? arrests cells at the G1/S transition by reducing cyclin E/CDK2 activity.
21792910 2011 Down-regulation of cyclin E1 expression by microRNA-195 accounts for interferon-?-induced inhibition of hepatic stellate cell proliferation.
21750416 2011 cAMP induces autophagy via a novel pathway involving ERK, cyclin E and Beclin 1.
21746877 2011 Hypoxia-inducible factor 1 is activated by dysregulated cyclin E during mammary epithelial morphogenesis.
21597324 2011 MiRNA-27a controls FBW7/hCDC4-dependent cyclin E degradation and cell cycle progression.
21515670 2011 c-ETS1 facilitates G1/S-phase transition by up-regulating cyclin E and CDK2 genes and cooperates with hepatitis B virus X protein for their deregulation.
21472690 2011 Expression of cell-cycle regulatory proteins BUBR1, MAD2, Aurora A, cyclin A and cyclin E in invasive ductal breast carcinomas.
21464733 2011 Significance of cell cycle regulatory proteins as malignant and prognostic biomarkers in ovarian epithelial tumors.
21458381 2011 Cyclin E1 is amplified and overexpressed in osteosarcoma.
21315112 2011 Regulation of IGF-1-dependent cyclin D1 and E expression by hEag1 channels in MCF-7 cells: the critical role of hEag1 channels in G1 phase progression.
21179471 2010 Down-regulation of mir-424 contributes to the abnormal angiogenesis via MEK1 and cyclin E1 in senile hemangioma: its implications to therapy.
21150326 2010 Impact of cyclin E overexpression on Smad3 activity in breast cancer cell lines.
21103391 2010 Amplicon-dependent CCNE1 expression is critical for clonogenic survival after cisplatin treatment and is correlated with 20q11 gain in ovarian cancer.
21092281 2010 HTLV-I p30 inhibits multiple S phase entry checkpoints, decreases cyclin E-CDK2 interactions and delays cell cycle progression.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20972438 2010 A multi-stage genome-wide association study of bladder cancer identifies multiple susceptibility loci.
20837705 2010 DDX3 regulates cell growth through translational control of cyclin E1.
20607601 2011 Three-dimensional collagen represses cyclin E1 via ?1 integrin in invasive breast cancer cells.
20530685 2010 Low molecular weight cyclin E overexpression shortens mitosis, leading to chromosome missegregation and centrosome amplification.
20530684 2010 Cyclin E deregulation impairs mitotic progression through premature activation of Cdc25C.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20465575 2010 In CD28-costimulated human naïve CD4+ T cells, I-?B kinase controls the expression of cell cycle regulatory proteins via interleukin-2-independent mechanisms.
20453888 2010 A novel interaction between HER2/neu and cyclin E in breast cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20385564 2010 p65 Negatively regulates transcription of the cyclin E gene.
20336784 2010 Gene amplification CCNE1 is related to poor survival and potential therapeutic target in ovarian cancer.
20171175 2010 Ribosomal protein L6 promotes growth and cell cycle progression through upregulating cyclin E in gastric cancer cells.
20107311 2010 Cyclin D3 is dispensable for human diffuse large B-cell lymphoma survival and growth: evidence for redundancy with cyclin E.
20102401 2010 BOB.1, CD79a and cyclin E are the most appropriate markers to discriminate classical Hodgkin's lymphoma from primary mediastinal large B-cell lymphoma.
20001501 2010 A study of the expression of Cyclin E and its isoforms in tumor and adjacent mucosa, correlated to patient outcome in early colon cancer.
19942931 2010 Mtd/Bok takes a swing: proapoptotic Mtd/Bok regulates trophoblast cell proliferation during human placental development and in preeclampsia.
19925052 2010 Prognostic immunophenotypic biomarker studies in diffuse large B cell lymphoma with special emphasis on rational determination of cut-off scores.
19860623 2009 Indirubin derivatives inhibit malignant lymphoid cell proliferation.
19801544 2009 Characterization of nuclear localization signal in the N terminus of CUL4B and its essential role in cyclin E degradation and cell cycle progression.
19787784 2010 Recurrent copy number gain of transcription factor SOX2 and corresponding high protein expression in oral squamous cell carcinoma.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19724860 2009 Potential role of Notch1 signaling pathway in laryngeal squamous cell carcinoma cell line Hep-2 involving proliferation inhibition, cell cycle arrest, cell apoptosis, and cell migration.
19713765 2009 Ultraviolet light induces the sustained unscheduled expression of cyclin E in the absence of functional p53.
19670700 2009 Immunohistochemical pattern of protein P21, cyclin D1 and cyclin E in endometrial hyperplasia.
19621596 2009 [Expression and significance of the cyclin E in laryngeal carcinomas].
19617534 2009 A hyperfused mitochondrial state achieved at G1-S regulates cyclin E buildup and entry into S phase.
19615252 2009 [Growth of breast cancer cells is inhibited in vitro by cyclin E-siRNA].
19603101 Role of E2F1-cyclin E1-cyclin E2 circuit in human coronary smooth muscle cell proliferation and therapeutic potential of its downregulation by siRNAs.
19587092 2009 Genetic susceptibility to the development and progression of breast cancer associated with polymorphism of cell cycle and ubiquitin ligase genes.
19585504 2009 Attenuation of proteolysis-mediated cyclin E regulation by alternatively spliced Parkin in human colorectal cancers.
19574535 2010 Gli2 influences proliferation in the developing lung through regulation of cyclin expression.
19569046 2009 Identification of novel hub genes associated with liver metastasis of gastric cancer.
19561641 2009 Post-translational modification and stability of low molecular weight cyclin E.
19505905 2009 Effects of nickel on cyclin expression, cell cycle progression and cell proliferation in human pulmonary cells.
19470724 2009 Integrative analysis of cyclin protein levels identifies cyclin b1 as a classifier and predictor of outcomes in breast cancer.
19454496 2009 Identification of the gene encoding cyclin E1 (CCNE1) as a novel IGH translocation partner in t(14;19)(q32;q12) in diffuse large B-cell lymphoma.
19423708 2009 Artemis regulates cell cycle recovery from the S phase checkpoint by promoting degradation of cyclin E.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19321444 2009 Coordinated activation of the origin licensing factor CDC6 and CDK2 in resting human fibroblasts expressing SV40 small T antigen and cyclin E.
19305161 2009 Low molecular weight cyclin E is specific in breast cancer and is associated with mechanisms of tumor progression.
19258477 2009 Candidate gene analysis using imputed genotypes: cell cycle single-nucleotide polymorphisms and ovarian cancer risk.
19236751 2009 [P27(Kip1), cyclin E and endogenous TGF-beta1 changes in apoptosis of NB4 cells induced by As(2)O(3) and/or TGF-beta1 and their significance].
19179977 2009 Prognostic relevance of cyclin E expression in operable breast cancer.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19107593 2009 Cyclin E deregulation is an early event in the development of breast cancer.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19058005 2009 Does the expression of cyclin E, pRb, and p21 correlate with prognosis in gastric adenocarcinoma?
19010853 2008 Loss of nuclear p27 expression and its prognostic role in relation to cyclin E and p53 mutation in gastroenteropancreatic neuroendocrine tumors.
18959818 2008 Ectopic EBP2 expression enhances cyclin E1 expression and induces chromosome instability in HEK293 stable clones.
18799789 2008 Cyclin E-dependent localization of MCM5 regulates centrosome duplication.
18799628 2008 cAMP-mediated induction of cyclin E sensitizes growth-arrested adipose stem cells to DNA damage-induced apoptosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18651214 2009 Down regulation of circadian clock gene Period 2 accelerates breast cancer growth by altering its daily growth rhythm.
18607847 2008 Aberrant expression of cyclin E in low-risk node negative breast cancer.
18507837 2008 Effects of common germline genetic variation in cell cycle control genes on breast cancer survival: results from a population-based cohort.
18381935 2008 Familial breast cancers without mutations in BRCA1 or BRCA2 have low cyclin E and high cyclin D1 in contrast to cancers in BRCA mutation carriers.
18344087 2008 [Prognostic value of cyclin E and its relation to blood vessel invasion in rectal cancer].
18301453 2006 The role of cyclins and cyclins inhibitors in the multistep process of HPV-associated cervical carcinoma.
18281541 2008 Effects of common germ-line genetic variation in cell cycle genes on ovarian cancer survival.
18276582 2008 Cyclin E and SV40 small T antigen cooperate to bypass quiescence and contribute to transformation by activating CDK2 in human fibroblasts.
18208561 2008 Spliceosomal protein E regulates neoplastic cell growth by modulating expression of cyclin E/CDK2 and G2/M checkpoint proteins.
18174243 2008 Association of single-nucleotide polymorphisms in the cell cycle genes with breast cancer in the British population.
18047954 Association of cyclin D1 and E1 expression with disease progression and biomarkers in patients with nonmuscle-invasive urothelial cell carcinoma of the bladder.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17822621 2007 [Cyclin E overexpression and centrosome amplification in squamous cell carcinoma of oral cavity].
17726548 2007 Elevated cyclin E level in human clear cell renal cell carcinoma: possible causes and consequences.
17664332 2007 Cyclin E overexpression impairs progression through mitosis by inhibiting APC(Cdh1).
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17434132 2007 Structure of a Fbw7-Skp1-cyclin E complex: multisite-phosphorylated substrate recognition by SCF ubiquitin ligases.
17409409 2007 Tagging single nucleotide polymorphisms in cell cycle control genes and susceptibility to invasive epithelial ovarian cancer.
17360482 2007 Transgenic cyclin E triggers dysplasia and multiple pulmonary adenocarcinomas.
17325036 2007 Interaction of a cyclin E fragment with Ku70 regulates Bax-mediated apoptosis.
17254967 2007 p27 phosphorylation by Src regulates inhibition of cyclin E-Cdk2.
17254966 2007 Cdk-inhibitory activity and stability of p27Kip1 are directly regulated by oncogenic tyrosine kinases.
17218276 2007 Kinase-independent function of cyclin E.
16912169 2006 HuR contributes to cyclin E1 deregulation in MCF-7 breast cancer cells.
16823179 2006 The prognostic value and overexpression of cyclin A is correlated with gene amplification of both cyclin A and cyclin E in breast cancer patient.
16799991 2006 Expression of a cyclin E1 isoform in mice is correlated with the quiescent cell cycle status of hepatocytes in vivo.
16765349 2006 Increased p21 expression and complex formation with cyclin E/CDK2 in retinoid-induced pre-B lymphoma cell apoptosis.
16761619 2006 Cyclin E expression in breast cancer correlates with negative steroid receptor status, HER2 expression, tumor grade and proliferation.
16740753 2006 Which cyclin E prevails as prognostic marker for breast cancer? Results from a retrospective study involving 635 lymph node-negative breast cancer patients.
16721056 2006 G1/S Cyclins interact with regulatory subunit of PKA via A-kinase anchoring protein, AKAP95.
16627785 2006 A calmodulin-binding site on cyclin E mediates Ca2+-sensitive G1/s transitions in vascular smooth muscle cells.
16609025 2006 Diffuse large B-cell lymphoma with overexpression of cyclin e substantiates poor standard treatment response and inferior outcome.
16582606 2006 Phosphorylation of RIalpha by cyclin-dependent kinase CDK 2/cyclin E modulates the dissociation of the RIalpha-RFC40 complex.
16538501 2006 Cyclin E but not bcl-2, bax or mcl-1 is differentially expressed in ZAP 70-positive and ZAP 70-negative B-CLL cells.
16504183 2006 Regulation of the transcription factor FOXM1c by Cyclin E/CDK2.
16391523 2005 CKbeta8-1 alters expression of cyclin E in colony forming units-granulocyte macrophage (CFU-GM) lineage from human cord blood CD34+ cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322693 2006 Involvement of CUL4 ubiquitin E3 ligases in regulating CDK inhibitors Dacapo/p27Kip1 and cyclin E degradation.
16223725 2006 The loss of PIN1 deregulates cyclin E and sensitizes mouse embryo fibroblasts to genomic instability.
16191374 2005 [Expression of p21WAF1, p27KIP1 and cyclin E in ameloblastoma].
16124066 2005 Expression of cell cycle regulator p57kip2, cyclinE protein and proliferating cell nuclear antigen in human pancreatic cancer: an immunohistochemical study.
16109376 2005 The bromodomain protein Brd4 is a positive regulatory component of P-TEFb and stimulates RNA polymerase II-dependent transcription.
15800668 2005 G1 arrest by p16INK4A uncouples growth from cell cycle progression in leukemia cells with deregulated cyclin E and c-Myc expression.
15709169 2005 Patterns of cyclin E, retinoblastoma protein, and p21Cip1/WAF1 immunostaining in the oncogenesis of papillary thyroid carcinoma.
15708847 2005 The tumor-specific hyperactive forms of cyclin E are resistant to inhibition by p21 and p27.
15665273 2005 Down-regulation of BRCA1-BARD1 ubiquitin ligase by CDK2.
15660127 2005 The structure of cyclin E1/CDK2: implications for CDK2 activation and CDK2-independent roles.
15611651 2004 Regulation of cyclin E protein levels through E2F-mediated inhibition of degradation.
15572661 2004 Negative modulation of androgen receptor transcriptional activity by Daxx.
15557791 2004 Cyclin E amplification and overexpression in clear cell adenocarcinoma of the ovary.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467469 2004 TRIP-Br links E2F to novel functions in the regulation of cyclin E expression during cell cycle progression and in the maintenance of genomic stability.
15197178 2004 Deregulation of cyclin E in human cells interferes with prereplication complex assembly.
15191351 2004 Cyclin E correlates with malignancy and adverse prognosis in adrenocortical tumors.
15178429 2004 NIRF induces G1 arrest and associates with Cdk2.
15060836 2004 Immunohistochemical expression of cyclin D1, cyclin E, p21/waf1 and p27/kip1 in inflammatory bowel disease: correlation with other cell-cycle-related proteins (Rb, p53, ki-67 and PCNA) and clinicopathological features.
15007381 2004 Cyclin E deregulation alters the biologic properties of ovarian cancer cells.
14965268 2004 A dual role of cyclin E in cell proliferation and apoptosis may provide a target for cancer therapy.
14719078 2004 Protein levels of p21, p27, cyclin E and Bax predict sensitivity to cisplatin and paclitaxel in head and neck squamous cell carcinomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645251 2004 Expression of cyclin E renders cyclin D-CDK4 dispensable for inactivation of the retinoblastoma tumor suppressor protein, activation of E2F, and G1-S phase progression.
14612403 2003 The cyclin E/Cdk2 substrate p220(NPAT) is required for S-phase entry, histone gene expression, and Cajal body maintenance in human somatic cells.
14536078 2003 Multisite phosphorylation by Cdk2 and GSK3 controls cyclin E degradation.
12824885 2003 The prognosis in spindle-cell sarcoma depends on the expression of cyclin-dependent kinase inhibitor p27(Kip1) and cyclin E.
12778072 2003 Expression of cyclin D1, D3, E, and p27 in human renal cell carcinoma analysed by tissue microarray.
12777997 2003 p27 and cyclin E/D2 associations in testicular germ cell tumors: implications for tumorigenesis.
12729791 2003 PKCeta associates with cyclin E/Cdk2 complex in serum-starved MCF-7 and NIH-3T3 cells.
12647795 2003 Expression of cyclin D3 and cyclin E and identification of distinct clusters of proliferation and apoptosis in diffuse large B-cell lymphomas.
12607005 2003 MDC1 is a mediator of the mammalian DNA damage checkpoint.
12601350 2003 Cyclins and cyclin-dependent kinases: comparative study of hepatocellular carcinoma versus cirrhosis.
12553912 2003 Structural basis for phosphodependent substrate selection and orientation by the SCFCdc4 ubiquitin ligase.
12533700 2003 Human cytomegalovirus immediate-early protein 2 (IE2)-mediated activation of cyclin E is cell-cycle-independent and forces S-phase entry in IE2-arrested cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444551 2002 Involvement of G1/S cyclins in estrogen-independent proliferation of estrogen receptor-positive breast cancer cells.
12133429 2002 [The significance of cyclin E expression and cyclin E-dependent kinase inhibitor in adult acute leukemia].
12114499 2002 HIV-1 Tat interaction with RNA polymerase II C-terminal domain (CTD) and a dynamic association with CDK2 induce CTD phosphorylation and transcription from HIV-1 promoter.
12101670 2002 [Prognostic importance of altered expression of cell cycle regulators in lung cancer].
12096344 2002 The cyclin D1 high and cyclin E high subgroups of breast cancer: separate pathways in tumorogenesis based on pattern of genetic aberrations and inactivation of the pRb node.
12096339 2002 Ectopic expression of cyclin E in estrogen responsive cells abrogates antiestrogen mediated growth arrest.
11919196 2002 Cyclin E is a target of WT1 transcriptional repression.
11907280 2002 Cyclin A- and cyclin E-Cdk complexes shuttle between the nucleus and the cytoplasm.
11877298 2002 Retinoic acid-induced cell cycle arrest of human myeloid cell lines is associated with sequential down-regulation of c-Myc and cyclin E and posttranscriptional up-regulation of p27(Kip1).
11838966 2001 TSG101 expression in gynecological tumors: relationship to cyclin D1, cyclin E, p53 and p16 proteins.
11733001 2001 ik3-1/Cables is a substrate for cyclin-dependent kinase 3 (cdk 3).
11565033 2001 Archipelago regulates Cyclin E levels in Drosophila and is mutated in human cancer cell lines.
11533444 2001 Phosphorylation-dependent ubiquitination of cyclin E by the SCFFbw7 ubiquitin ligase.
11259605 2001 Two immunologically distinct human DNA polymerase alpha-primase subpopulations are involved in cellular DNA replication.
11237742 2001 The F-box protein SKP2 binds to the phosphorylated threonine 380 in cyclin E and regulates ubiquitin-dependent degradation of cyclin E.
11221854 2001 Intranuclear compartmentalization of cyclin E during the cell cycle: disruption of the nucleoplasm-nucleolar shuttling of cyclin E in bladder cancer.
11175348 2000 PKCeta associates with cyclin E/cdk2/p21 complex, phosphorylates p21 and inhibits cdk2 kinase in keratinocytes.
10995387 2000 Cell cycle-regulated phosphorylation of p220(NPAT) by cyclin E/Cdk2 in Cajal bodies promotes histone gene transcription.
10995386 2000 NPAT links cyclin E-Cdk2 to the regulation of replication-dependent histone gene transcription.
10953010 2000 Cyclin E as a coactivator of the androgen receptor.
10908655 2000 Down-regulation of p21WAF1/CIP1 or p27Kip1 abrogates antiestrogen-mediated cell cycle arrest in human breast cancer cells.
10851086 2000 Cyclin E induction by genotoxic stress leads to apoptosis of hematopoietic cells.
10827081 2000 NIPP1-mediated interaction of protein phosphatase-1 with CDC5L, a regulator of pre-mRNA splicing and mitotic entry.
10751146 2000 Cell cycle-dependent localization of the CDK2-cyclin E complex in Cajal (coiled) bodies.
10581175 1999 A novel human gene encoding HECT domain and RCC1-like repeats interacts with cyclins and is potentially regulated by the tumor suppressor proteins.
10500095 1999 Cullin-3 targets cyclin E for ubiquitination and controls S phase in mammalian cells.
10499591 1999 Deregulated cyclin E induces chromosome instability.
10454565 1999 Ectopic expression of Cdc25A accelerates the G(1)/S transition and leads to premature activation of cyclin E- and cyclin A-dependent kinases.
10330164 1999 Specificity of cyclin E-Cdk2, TFIIB, and E1A interactions with a common domain of the p300 coactivator.
9891079 1999 Cyclin E associates with BAF155 and BRG1, components of the mammalian SWI-SNF complex, and alters the ability of BRG1 to induce growth arrest.
9840943 1998 Cyclin E2, a novel human G1 cyclin and activating partner of CDK2 and CDK3, is induced by viral oncoproteins.
9819444 1998 Maturation of human cyclin E requires the function of eukaryotic chaperonin CCT.
9731206 1998 Association of Cdk2/cyclin E and NF-kappa B complexes at G1/S phase.
9525916 1998 HIV-1 Tat elongates the G1 phase and indirectly promotes HIV-1 gene expression in cells of glial origin.
9472014 1998 Expression of NPAT, a novel substrate of cyclin E-CDK2, promotes S-phase entry.
9223324 1997 Tat protein induces self-perpetuating permissivity for productive HIV-1 infection.
9192874 1997 Cyclin E-induced S phase without activation of the pRb/E2F pathway.
9153308 1997 Cyclin ET, a new splice variant of human cyclin E with a unique expression pattern during cell cycle progression and differentiation.
9012818 1997 Activation of human B-MYB by cyclins.
8861947 1996 Activation of cyclin E/CDK2 is coupled to site-specific autophosphorylation and ubiquitin-dependent degradation of cyclin E.
8833152 1996 Molecular cloning and chromosomal localization of the human cyclin C (CCNC) and cyclin E (CCNE) genes: deletion of the CCNC gene in human tumors.
8756624 1996 Cyclin-binding motifs are essential for the function of p21CIP1.
8649818 1996 Regulation of cyclin E transcription by E2Fs and retinoblastoma protein.
8618861 1995 Regulation of the cyclin E gene by transcription factor E2F1.
8617791 1996 Roles of active site residues and the NH2-terminal domain in the catalysis and substrate binding of human Cdc25.
8553588 1996 Human papillomavirus E7 oncoproteins bind a single form of cyclin E in a complex with cdk2 and p107.
8253383 1993 The adenovirus E1A-associated 130-kD protein is encoded by a member of the retinoblastoma gene family and physically interacts with cyclins A and E.
8230483 1993 Analysis of p107-associated proteins: p107 associates with a form of E2F that differs from pRB-associated E2F-1.
8207080 1994 Alternative splicing of human cyclin E.
7799941 1995 Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2.
7739542 1995 Human cyclin E, a nuclear protein essential for the G1-to-S phase transition.
7698009 1995 Chromosomal mapping of the genes for the human cell cycle proteins cyclin C (CCNC), cyclin E (CCNE), p21 (CDKN1) and KAP (CDKN3).
7629134 1995 Both p16 and p21 families of cyclin-dependent kinase (CDK) inhibitors block the phosphorylation of cyclin-dependent kinases by the CDK-activating kinase.
1833068 1991 Human cyclin E, a new cyclin that interacts with two members of the CDC2 gene family.
1833066 1991 Isolation of three novel human cyclins by rescue of G1 cyclin (Cln) function in yeast.
1388288 1992 Formation and activation of a cyclin E-cdk2 complex during the G1 phase of the human cell cycle.
1388095 1992 Regulation of retinoblastoma protein functions by ectopic expression of human cyclins.