Property Summary

NCBI Gene PubMed Count 146
PubMed Score 299.62
PubTator Score 253.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.049 3.4e-02
medulloblastoma, large-cell -1.300 1.1e-04
non-small cell lung cancer -1.408 1.8e-21
lung cancer -3.300 9.7e-07
lung adenocarcinoma -1.400 2.5e-09
ovarian cancer 1.300 6.8e-05

Protein-protein Interaction (13)

Gene RIF (95)

PMID Text
26055066 cyclin-D1 and cyclin-D3 within human islet cells varies according to the status of the pancreas donor
26026083 G1 arrest induced by SB265610 occurred at concentrations lacking CXCR2 selectivity and revealed cyclin-dependent kinase 2 (CDK2) (Thr160) hypophosphorylation, cyclin D3 gene down-regulation, and p21 post-translational induction
25927932 The CDK6-cyclin D3 pair play a fundamental role in controlling CDK2-dependent SAMHD1 phosphorylation and the dNTP pool in primary macrophages.
25704763 HIV-1 MA natural variant S75X upregulates the expression of two cyclins D2 and D3, and induces significant release of cytokine IL-6, which leads to enhance proliferation of both Epstein-Barr virus (EBV)-infected primary and fully transformed B-lymphocytes
25439221 combined expression of miR-138 and its direct target CCND3 may be correlated with significant characteristics of hepatocellular carcinoma
25300797 Two recurrent fusion genes associated with the 12q locus, LRP1-SNRNP25 and KCNMB4-CCND3, were by RT-PCR, Sanger sequencing and FISH, and were found to be osteosarcoma specific in a validation cohort of 240 other sarcomas.
25160985 Namely the amplification of the expression of the PLCB1a, but not of PLCB1b, is able to maintain high levels of expression of cyclin D3 even after treatment with kinamycin F
24441043 sLZIP regulates the transcription of cyclin D3 by binding directly to the AP-1 region in the cyclin D3 promoter.
23967867 two cell cycle-related molecules, cyclin D3 and E2F3, were identified as the direct miR-503 targets.
23963898 cell cycle related proteins PCNA, Ki67, cyclin D3, p27 and p57 were expressed in both normal and diabetic human term placentas.
23830405 CCND3 gene amplification is a marker of aggressiveness and might be a predictor of tumor progression in bladder urothelial carcinoma
23812426 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
23422111 PCNSL prognosis is relatively poor. Age, high tumor burden, higher lymphocyte count, expression of Cyclin D3, and Cyclin E are inferior prognostic factors for PCNSL.
23376478 Lycorine hydrochloride effectively inhibited mitotic proliferation of Hey1B cells through enhanced expression of the cell cycle inhibitor p21 and marked down-regulation of cyclin D3 expression.
23240690 7 gains of CCND3 were seen amon 17 orbital adnexa MALT lymphomas. CCND3 might simply be a marker of 6p gains and not play a major role in the pathogenesis of MALT lymphomas.
23160194 cyclin D3 is reduced in myotonic dystrophy due to increased phosphorylation at T283 by GSK3beta, which triggers the degradation of cyclin D3.
22858673 Study reports that a cis-acting element, located between nucleotides 31 and 50 of the human CCND3 5' UTR, forms a stable G-quadruplex structure and represses translation of a reporter gene and the CCND3 gene in human cell lines.
22763761 No significant correlation was found between p-27, Cyclin D3, and cyclin E in pediatric Embryonal tumors
22362728 CCND3 protein expression was observed to be negatively correlated with miR-138 expression in HCC tissues.
22037875 Data show that cyclin D3 is significantly upregulated in breast cancers and frequently exceeds the expression of Cyclin D1 in ErbB2-positive cases.
21965782 Lymph node sections from 138 HL patients were immunohistochemically stained for cyclin D3 (CCND3), MCM2 and MCM7 aiming to investigate clinical outcome.
21841808 The overexpression of ETS1 could suppress cyclin D3 mRNA and protein levels.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20821231 study suggests that Cyclin D3 gene amplification might be a predictor of aggressiveness in BCG-treated bladder urothelial carcinoma in situ
20631637 Overexpressions of nuclear cyclin D3 is associated with non-small cell lung cancer.
20465575 In addition to having a pivotal role in the up-regulation of IL-2 and IL-2RA gene expression, IKK controls the expression of cyclin D3, cyclin E and CDK2, and the stability SKP2 and its co-factor CKS1B, through mechanisms independent of IL-2.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20229177 These results suggest that alpha9-nAChR-mediated cyclin D3 overexpression is important for nicotine-induced transformation of normal human breast epithelial cells.
20113529 CCND3 is the primary driver of the cell cycle, in cooperation with CCND1 that integrates extracellular mitogenic signaling.
20107311 Gene knockdown of cyclin D3 did not inhibit pRb phosphorylation on cdk4/6- and cdk2-specific residues or measurably affect viability and proliferation.
20097574 CKbeta8- and CKbeta8-1-induced activation of ERK1/2 is mediated by the G(i)/G(o) protein, PLC, and PKCdelta.
19853236 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19738611 Observational study of gene-disease association. (HuGE Navigator)
19706544 Data show that ICP0 binds cyclin D3 and that ICP0 mutants unable to bind cyclin D3 are not exported.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19639271 seven large B cell lymphoma patients showing the involvement of tumor cells with cyclin D3 (CCND3) expression in bone marrow (BM) at the initial diagnosis
19625176 Observational study of gene-disease association. (HuGE Navigator)
19473963 ectopic expression of PFKFB3 increased the expression of several key cell cycle proteins, including cyclin-dependent kinase (Cdk)-1, Cdc25C, and cyclin D3 and decreased the expression of the cell cycle inhibitor p27
19258477 Observational study of gene-disease association. (HuGE Navigator)
19237555 determined the structure of nonphosphorylated CDK4/cyclin D3;results suggest that the structural mechanism of CDK4/cyclin D3 activation differs markedly from that of previously studied CDK/cyclin complexes
19204726 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19142864 Decreased expression of CCND3 is associated with Increased expression of HER2 in breast tumors.
19142864 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
18701138 We report a direct correlation between cyclin D3 and p27 expression in gastrointestinal stromal tumors.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18570922 Results show that ectopic expression of cyclin D3 corrects differentiation of DM1 myoblasts through activation of CUGBP1.
18507837 Observational study of gene-disease association. (HuGE Navigator)
18391076 cyclin E expression in 2 t(11;14)-negative mantle cell lymphomas characterized by a cryptic t(2;14)(p24;q32) and identification of MYCN as a new lymphoma oncogene associated with a blastoid mantle cell lymphoma
18358634 Report overexpression of cyclin D1, D3, and p21 in renal carcinomas with Xp11.2 TFE3-gene fusion.
18281541 Observational study of gene-disease association. (HuGE Navigator)
18174243 Observational study of gene-disease association. (HuGE Navigator)
18084330 Cyclin D3 is a critical modulator of the androgen response, whose deregulation may foster unchecked AR activity in prostate cancer.
18019405 high cyclin expression may contribute to deregulation of the cell cycle in bone and soft tissue tumors
17885491 absent or decreased cyclin D3 expression is adversely related to several clinicopathologic indicators of aggressiveness in ovarian adenocarcinomas
17882269 role for D-type cyclins in the excessive basal-cell proliferation and perturbed keratinocyte differentiation in the psoriatic epidermis
17698582 These data suggest that cyclin D3/CDK11p58 signaling is involved in the negative regulation of AR function.
17467662 E1AF increases cell cycle progression via upregulation of Cyclin D3 transcription, which elicits a new mechanism of breast cancer growth and a new mechanism of Cyclin D3 transcription
17413032 SARS-CoV 3a protein, through limiting the expression of cyclin D3, may inhibit Rb phosphorylation, which in turn leads to a block in the G1 phase of the cell cycle and an inhibition of cell proliferation
17409409 Observational study of gene-disease association. (HuGE Navigator)
17300668 Cyclin D3 expression was expressed in human precursor T-lymphoblastic leukemia/lymphomas (T-LBLL), a neoplastic counterpart of T cells at the early developmental stages of differentiation.
16920920 all-trans retinoic acid(RA), via RA receptor, stimulates IL-2-induced signaling in a JAK-dependent manner to enhance cyclin D3 expression and thereby promote T cell proliferation
16916940 Cyclin D1 or cyclin D3 are differentially used in the distinct mitogenic stimulations by growth factors or TSH.
16884382 cyclin D3 overexpression with the loss of PTEN expression is associated with endometrial carcinoma
16815849 cyclin D3 is an important regulator of melanoma G1-S cell cycle progression and D-type cyclins are differentially regulated in melanoma cells
16569260 Galangin, abioflavonoid, may be useful as a chemotherapeutic agent in breast cancer by downregulation of cyclin D3.
16360641 These findings further expand distinct roles of cyclin D3 and suggest the potential activity of ERK3 in cell proliferation.
16322284 Overexpression of CCND3 through genomic amplification is associated with diffuse large B-cell lymphoma
16303160 Sars virus 7a protein expression was correlated with a significant reduction of cyclin D3 level of mRNA transcription and expression and prevention of cell cycle progression at the G0/G1 phase.
16300731 activating transcription factor 5 increases cisplatin-induced apoptosis through up-regulation of Cyclin D3 transcription, which elicits survival signals in HeLa cells
16287839 direct association of cyclin D3 with runt-related transcription factor 1 functions as a putative feedback mechanism to regulate cell cycle progression and differentiation
16105657 Cyclin D3 up-regulated transcriptional activity of VDR and this effect was counteracted by overexpression of CDK4 and CDK6
15755896 Cyclin D1, D2, or D3 expression appears to be increased and/or dysregulated in virtually all MM tumors despite their low proliferative capacity
15671552 cyclin D3 may have a role in progression of laryngeal squamous cell carcinoma
15569667 silencing cyclin D3 by RNA interference inhibits S phase entry and sensitizes breast cancer cells to TRAIL, indicating a key role for cyclin D3 repression in these events
15358120 activating transcription factor 5 (ATF5) is a new interacting partner of cyclin D3
15327989 cyclin D3 specifically interacted with eIF3k through its C-terminal domain; eIF3k distributed both in nucleus and cytoplasm and colocalized with cyclin D3
15326477 cyclin D3 is degraded via proteasome and that Thr-283 is essential for its degradation
15305377 Increased expression of Cyclin D3 is associated with follicular lymphoma
15252116 GSK-3beta has a role in cAMP-induced degradation of cyclin D3
15050687 HIV-1 MA natural variant S75X upregulates the expression of two cyclins D2 and D3, and induces significant release of cytokine IL-6, which leads to enhance proliferation of both Epstein-Barr virus (EBV)-infected primary and fully transformed B-lymphocytes
14747476 cyclin d3 does not have a role in regulating AML1/RUNX1 increase during G1 to S cell cycle progression
14666699 In cervical cancers cyclin D3 may compensate for low levels of cyclin D1, whereas in corpus cancers both isoforms may contribute to the neoplastic phenotype.
14645576 stabilized by HSV-1 ICP0 through degradation of cdc34
14576819 cyclin D3 protein is expressed in a fraction of human goiters but it is strongly overexpressed in most follicular adenomas
12778072 High levels of this protein are gound in malignant glioma.
12647795 overexpression of cyclin D3 was mutually exclusive with Rb/p16 aberrant expression status supporting an oncogenic role for cyclin D3
12611887 cyclin D3 is activated by E2F1;the essential E2F regulatory element of the cyclin D3 promoter is between nucleotides -143 and -135 relative to the initiating methionine codon
12482873 A cofactor of retinoic acid receptors, modulating their activity in the presence of cellular retinoic acid-binding protein II.
12082095 interaction with p58(PITSLRE)
11895902 High cyclin D3 expression had a significantly lower response to antineoplastic agents in diffuse large B-cell lymphomas
11864973 Ubiquitin/proteasome-dependent degradation of D-type cyclins is linked to tumor necrosis factor-induced cell cycle arrest.
8668211 Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.

AA Sequence

MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEE      1 - 70
QRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDW     71 - 140
EVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGA    141 - 210
AVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQ    211 - 280
TSTPTDVTAIHL                                                              281 - 292
//

Text Mined References (152)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26055066 2015 The subcellular distribution of cyclin-D1 and cyclin-D3 within human islet cells varies according to the status of the pancreas donor.
26026083 2015 Induction of G1 Arrest by SB265610 Involves Cyclin D3 Down-regulation and Suppression of CDK2 (Thr160) Phosphorylation.
25927932 2015 Cyclin D3-dependent control of the dNTP pool and HIV-1 replication in human macrophages.
25439221 2015 Clinical significance of microRNA 138 and cyclin D3 in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25300797 2014 Recurrent LRP1-SNRNP25 and KCNMB4-CCND3 fusion genes promote tumor cell motility in human osteosarcoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25160985 2015 PLC?1a and PLC?1b selective regulation and cyclin D3 modulation reduced by kinamycin F during k562 cell differentiation.
24441043 2015 The role of sLZIP in cyclin D3-mediated negative regulation of androgen receptor transactivation and its involvement in prostate cancer.
23967867 2013 MicroRNA-503 inhibits the G1/S transition by downregulating cyclin D3 and E2F3 in hepatocellular carcinoma.
23963898 2014 Immunohistochemical distribution of cell cycle proteins p27, p57, cyclin D3, PCNA and Ki67 in normal and diabetic human placentas.
23830405 Fluorescence in situ hybridization analysis of CCND3 gene as marker of progression in bladder carcinoma.
23812426 2014 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23422111 2013 Prognostic value of clinical characteristics and immunophenotypic biomarkers in 115 patients with primary central nervous system lymphoma.
23376478 2013 Lycorine hydrochloride selectively inhibits human ovarian cancer cell proliferation and tumor neovascularization with very low toxicity.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23240690 2013 Gains of CCND3 gene in ocular adnexal MALT lymphomas: an integrated analysis.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160194 2012 GSK3? mediates muscle pathology in myotonic dystrophy.
22858673 2012 Translational repression of cyclin D3 by a stable G-quadruplex in its 5' UTR: implications for cell cycle regulation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22763761 2012 Immunohistochemical expression of cell-cycle regulators in pediatric embryonal brain tumors.
22362728 2012 MiR-138 induces cell cycle arrest by targeting cyclin D3 in hepatocellular carcinoma.
22037875 2011 Cyclin D3 compensates for the loss of cyclin D1 during ErbB2-induced mammary tumor initiation and progression.
22020328 2012 F-box protein FBXL2 exerts human lung tumor suppressor-like activity by ubiquitin-mediated degradation of cyclin D3 resulting in cell cycle arrest.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21965782 2011 Immunohistochemical expression and prognostic significance of CCND3, MCM2 and MCM7 in Hodgkin lymhoma.
21841808 2011 Negative regulation of cyclin D3 expression by transcription factor c-Ets1 in umbilical cord hematopoietic cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20821231 2010 Cyclin D3 gene amplification in bladder carcinoma in situ.
20631637 2010 Deregulation of p27 and cyclin D1/D3 control over mitosis is associated with unfavorable prognosis in non-small cell lung cancer, as determined in 405 operated patients.
20465575 2010 In CD28-costimulated human naïve CD4+ T cells, I-?B kinase controls the expression of cell cycle regulatory proteins via interleukin-2-independent mechanisms.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20229177 2011 Nicotine-induced human breast cancer cell proliferation attenuated by garcinol through down-regulation of the nicotinic receptor and cyclin D3 proteins.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20113529 2010 Differential roles of cyclin D1 and D3 in pancreatic ductal adenocarcinoma.
20107311 2010 Cyclin D3 is dispensable for human diffuse large B-cell lymphoma survival and growth: evidence for redundancy with cyclin E.
20097574 2010 CKbeta8/CCL23 and its isoform CKbeta8-1 induce up-regulation of cyclins via the G(i)/G(o) protein/PLC/PKCdelta/ERK leading to cell-cycle progression.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19853236 2009 Sequence variants in three loci influence monocyte counts and erythrocyte volume.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19706544 2009 ICP0 enables and monitors the function of D cyclins in herpes simplex virus 1 infected cells.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19639271 2009 Bone marrow large B cell lymphoma bearing cyclin D3 expression: clinical, morphologic, immunophenotypic, and genotypic analyses of seven patients.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19473963 2009 Nuclear targeting of 6-phosphofructo-2-kinase (PFKFB3) increases proliferation via cyclin-dependent kinases.
19258477 2009 Candidate gene analysis using imputed genotypes: cell cycle single-nucleotide polymorphisms and ovarian cancer risk.
19237555 2009 The structure of CDK4/cyclin D3 has implications for models of CDK activation.
19204726 2009 Transcriptomic and genetic studies identify IL-33 as a candidate gene for Alzheimer's disease.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19142864 2009 Polymorphic loci of E2F2, CCND1 and CCND3 are associated with HER2 status of breast tumors.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18701138 2008 Increased cyclin D3 expression significantly correlates with p27 nuclear positivity in gastrointestinal stromal tumors.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18570922 2008 Ectopic expression of cyclin D3 corrects differentiation of DM1 myoblasts through activation of RNA CUG-binding protein, CUGBP1.
18507837 2008 Effects of common germline genetic variation in cell cycle control genes on breast cancer survival: results from a population-based cohort.
18391076 2008 Translocations targeting CCND2, CCND3, and MYCN do occur in t(11;14)-negative mantle cell lymphomas.
18358634 2008 Overexpression of cyclin D1, D3, and p21 in an infantile renal carcinoma with Xp11.2 TFE3-gene fusion.
18281541 2008 Effects of common germ-line genetic variation in cell cycle genes on ovarian cancer survival.
18174243 2008 Association of single-nucleotide polymorphisms in the cell cycle genes with breast cancer in the British population.
18084330 2008 Cyclin D3 action in androgen receptor regulation and prostate cancer.
18019405 Altered expression of cell cycle regulatory proteins in benign and malignant bone and soft tissue neoplasms.
17885491 2007 Expression and prognostic significance of cyclin D3 in ovarian adenocarcinomas.
17882269 2008 Differential expression of D-type cyclins in HaCaT keratinocytes and in psoriasis.
17698582 2007 Cyclin D3/CDK11p58 complex is involved in the repression of androgen receptor.
17517622 2007 Functional characterization of human PFTK1 as a cyclin-dependent kinase.
17467662 2007 E1AF promotes breast cancer cell cycle progression via upregulation of Cyclin D3 transcription.
17413032 2007 G1 phase cell cycle arrest induced by SARS-CoV 3a protein via the cyclin D3/pRb pathway.
17409409 2007 Tagging single nucleotide polymorphisms in cell cycle control genes and susceptibility to invasive epithelial ovarian cancer.
17300668 2007 Development-dependent expression of cyclin D3 in precursor T-cell lymphoblastic leukemia/lymphoma.
17274640 2007 A limited screen for protein interactions reveals new roles for protein phosphatase 1 in cell cycle control and apoptosis.
16920920 2006 All-trans retinoic acid stimulates IL-2-mediated proliferation of human T lymphocytes: early induction of cyclin D3.
16916940 2006 Differential utilization of cyclin D1 and cyclin D3 in the distinct mitogenic stimulations by growth factors and TSH of human thyrocytes in primary culture.
16884382 Correlation of cyclin D1 and cyclin D3 overexpression with the loss of PTEN expression in endometrial carcinoma.
16815849 2006 Cyclin D3 expression in melanoma cells is regulated by adhesion-dependent phosphatidylinositol 3-kinase signaling and contributes to G1-S progression.
16782892 2006 Regulated activating Thr172 phosphorylation of cyclin-dependent kinase 4(CDK4): its relationship with cyclins and CDK "inhibitors".
16721056 2006 G1/S Cyclins interact with regulatory subunit of PKA via A-kinase anchoring protein, AKAP95.
16569260 2006 Growth of a human mammary tumor cell line is blocked by galangin, a naturally occurring bioflavonoid, and is accompanied by down-regulation of cyclins D3, E, and A.
16360641 2006 Identification of extracellular signal-regulated kinase 3 as a new interaction partner of cyclin D3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322284 2005 Identification of CCND3 and BYSL as candidate targets for the 6p21 amplification in diffuse large B-cell lymphoma.
16303160 2006 SARS coronavirus 7a protein blocks cell cycle progression at G0/G1 phase via the cyclin D3/pRb pathway.
16300731 2006 ATF5 increases cisplatin-induced apoptosis through up-regulation of cyclin D3 transcription in HeLa cells.
16287839 2005 The hematopoietic transcription factor AML1 (RUNX1) is negatively regulated by the cell cycle protein cyclin D3.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16105657 2005 Cyclin D3 interacts with vitamin D receptor and regulates its transcription activity.
15755896 2005 Cyclin D dysregulation: an early and unifying pathogenic event in multiple myeloma.
15671552 2005 Cyclin D3 immunoreactivity is an independent predictor of survival in laryngeal squamous cell carcinoma.
15569667 2005 Peroxisome proliferator-activated receptor gamma agonists promote TRAIL-induced apoptosis by reducing survivin levels via cyclin D3 repression and cell cycle arrest.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358120 2004 Cyclin D3 interacts with human activating transcription factor 5 and potentiates its transcription activity.
15327989 2004 Identification of the p28 subunit of eukaryotic initiation factor 3(eIF3k) as a new interaction partner of cyclin D3.
15326477 2004 P38SAPK2 phosphorylates cyclin D3 at Thr-283 and targets it for proteasomal degradation.
15305377 2004 Cyclin D3 immunoreactivity in follicular lymphoma is independent of the t(6;14)(p21.1;q32.3) translocation or cyclin D3 gene amplification and is correlated with histologic grade and Ki-67 labeling index.
15252116 2004 cAMP-induced degradation of cyclin D3 through association with GSK-3beta.
15232106 2004 Self-assembling protein microarrays.
14747476 2004 AML1/RUNX1 increases during G1 to S cell cycle progression independent of cytokine-dependent phosphorylation and induces cyclin D3 gene expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14666699 Deregulation of D-type cyclins in uterine cancers. Cyclin D1/D3 is differentially expressed in cervical cancer.
14645576 2003 Herpes simplex virus 1 mutant in which the ICP0 HUL-1 E3 ubiquitin ligase site is disrupted stabilizes cdc34 but degrades D-type cyclins and exhibits diminished neurotoxicity.
14641107 2004 A novel partner for D-type cyclins: protein kinase A-anchoring protein AKAP95.
14576819 2003 Critical role of cyclin D3 in TSH-dependent growth of thyrocytes and in hyperproliferative diseases of the thyroid gland.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12890807 2003 p27 Kip1 protein expression in Hashimoto's thyroiditis.
12778072 2003 Expression of cyclin D1, D3, E, and p27 in human renal cell carcinoma analysed by tissue microarray.
12647795 2003 Expression of cyclin D3 and cyclin E and identification of distinct clusters of proliferation and apoptosis in diffuse large B-cell lymphomas.
12611887 2003 Regulation of the cyclin D3 promoter by E2F1.
12482873 2003 Cyclin D3 is a cofactor of retinoic acid receptors, modulating their activity in the presence of cellular retinoic acid-binding protein II.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130539 2002 Cyclin D-cdk4 activity modulates the subnuclear localization and interaction of MEF2 with SRC-family coactivators during skeletal muscle differentiation.
12082095 2002 Interaction of p58(PITSLRE), a G2/M-specific protein kinase, with cyclin D3.
12036888 2002 Evidence for distinct pathomechanisms in B-cell chronic lymphocytic leukemia and mantle cell lymphoma by quantitative expression analysis of cell cycle and apoptosis-associated genes.
12011445 2002 Cyclin D3 activates Caspase 2, connecting cell proliferation with cell death.
11896535 2002 Cell cycle progression of chronic lymphocytic leukemia cells is controlled by cyclin D2, cyclin D3, cyclin-dependent kinase (cdk) 4 and the cdk inhibitor p27.
11864973 2002 Ubiquitin/proteasome-dependent degradation of D-type cyclins is linked to tumor necrosis factor-induced cell cycle arrest.
11726322 2001 Cell cycle regulatory proteins and apoptosis in B-cell chronic lymphocytic leukemia.
11469683 2001 Induction and expression of cyclin D3 in human pancreatic cancer.
11375949 2001 Aberrant expression of G1-phase cell cycle regulators in flat and exophytic adenomas of the human colon.
11360184 2001 Cdk6-cyclin D3 complex evades inhibition by inhibitor proteins and uniquely controls cell's proliferation competence.
11301189 2001 Novel expression of cyclin-dependent kinase inhibitors in human B-cell precursors.
11042687 2000 NPDC-1, a regulator of neural cell proliferation and differentiation, interacts with E2F-1, reduces its binding to DNA and modulates its transcriptional activity.
10891505 2000 Evidence for a telomere-independent "clock" limiting RAS oncogene-driven proliferation of human thyroid epithelial cells.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10398124 1999 D-type cyclins in adult human testis and testicular cancer: relation to cell type, proliferation, differentiation, and malignancy.
10342870 1999 Developmentally regulated expression of cyclin D3 and its potential in vivo interacting proteins during murine gametogenesis.
10318807 1999 A cyclin D-Cdk4 activity required for G2 phase cell cycle progression is inhibited in ultraviolet radiation-induced G2 phase delay.
9858559 1999 Cyclin D- and E-dependent kinases and the p57(KIP2) inhibitor: cooperative interactions in vivo.
9713342 1998 Cyclin D3 expression in normal, reactive and neoplastic tissues.
9311810 1997 Herpes simplex virus 1 alpha regulatory protein ICP0 interacts with and stabilizes the cell cycle regulator cyclin D3.
9106657 1997 New functional activities for the p21 family of CDK inhibitors.
8887674 1996 Interaction of D-type cyclins with a novel myb-like transcription factor, DMP1.
8668211 1996 Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
8621559 1996 Functional analysis of the human cyclin D2 and cyclin D3 promoters.
8490963 1993 Physical interaction of the retinoblastoma protein with human D cyclins.
8114739 1994 Identification of G1 kinase activity for cdk6, a novel cyclin D partner.
7908906 1994 D-type cyclin-binding regions of proliferating cell nuclear antigen.
1387066 1992 Assignment of the human cyclin D3 gene (CCND3) to chromosome 6p----q13.
1386336 1992 Molecular cloning and chromosomal mapping of CCND genes encoding human D-type cyclins.
1386335 1992 Genomic organization, chromosomal localization, and independent expression of human cyclin D genes.
1383201 1992 Cloning and characterization of human cyclin D3, a cDNA closely related in sequence to the PRAD1/cyclin D1 proto-oncogene.