Property Summary

NCBI Gene PubMed Count 147
PubMed Score 381.13
PubTator Score 287.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Peripheral vascular disease 90 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 5.227 2.6

Expression

  Differential Expression (35)

 GO Function (1)

Protein-protein Interaction (7)

Gene RIF (101)

PMID Text
26707908 this study shows that miR-124-3p may negatively regulate the transcription of the STAT3 by interfering with its 3'UTR, and the degradation of STAT3 affects its downstream expression of such as p-STAT3, CCND2 and MMP-2
26341922 these results highlight the impact of CCND2 3'UTR shortening on miRNA-dependent regulation of CCND2 in multiple myeloma.
26290144 The results do not support our hypothesis that common germline genetic variants in the CCND2 genes is associated with the risk of developing medulloblastoma.
26225959 miR-198 inhibited HaCaT cell proliferation by directly targeting CCND2.
26221902 Up-regulation of clyclinD2 regulates laryngeal squamous cell carcinoma cell growth.
25980436 CCND2 was identified as a putative target gene for SMYD3 transcriptional regulation, through trimethylation of H4K20.Our results support a proto-oncogenic role for SMYD3 in prostate carcinogenesis, mainly due to its methyltransferase enzymatic activity.
25961636 Treatment of rSCC-61 and SCC-61 with the DNA hypomethylating agent 5-aza-2'deoxycitidine increased CCND2 levels only in rSCC-61 cells, while treatment with the control reagent cytosine arabinoside did not influence the expression of this gene
25960238 the dysregulation of miR-206-CCND2 axis may contribute to the aggressive progression and poor prognosis of human gastric cancer.
25824739 Cyclin D2 hypermethylation is associated with breast cancer.
25817794 that re-introducing CDK6, cyclin-D1 or cyclin-D2 expression partially, but significantly, rescues cells from the suppression of cell proliferation and cell cycle arrest mediated by miR-340
25738424 Methylation changes were enriched in MSX1, CCND2, and DAXX at specific loci within the hippocampus of patients with schizophrenia and bipolar disorder.
25704763 HIV-1 MA natural variant S75X upregulates the expression of two cyclins D2 and D3, and induces significant release of cytokine IL-6, which leads to enhance proliferation of both Epstein-Barr virus (EBV)-infected primary and fully transformed B-lymphocytes
25673160 OY-TES-1 downregulation in liver cancer cells promotes cell proliferation by upregulating CCND2 and CDCA3.
25605810 Study establishes that a low-frequency allele in CCND2 halves the risk of type 2 diabetes primarily through enhanced insulin secretion.
25605810 study establishes that a low frequency allele in CCND2 halves the risk of type 2 diabetes primarily through enhanced insulin secretion
25572712 miR206 inhibits glioma progression via the regulation of cyclinD2 and that miR206 may be a novel biomarker with potential for use as a therapeutic target in gliomas.
25193387 Stepwise Cox regression modelling suggested that the methylation of genes HSPB1, CCND2 and DPYS contributed objective prognostic information to Gleason score and PSA with respect to prostate cancer-related death.
24992041 Together, this study has uncovered a positive role of cyclin D2 in hepatitis B virus replication.
24743557 results provide evidence that CCND2 polymorphism rs3217927 may be involved in the etiology of childhood ALL, and the GG genotype of rs3217927 may modulate the genetic susceptibility to childhood ALL in the Chinese population.
24705253 De novo CCND2 mutations leading to stabilization of cyclin D2 cause megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome.
24464100 A low-frequency (1.47%) variant in intron 1 of CCND2, rs76895963[G], reduces risk of type 2 diabetes by half (odds ratio (OR) = 0.53, P = 5.0 x 10(-21)) and is correlated with increased CCND2 expression.
24249158 Frequent aberrations of CCND2 and RB1 is associated with intracranial germ cell tumors
23989931 Study reveals molecular insight into how the Ets family transcription factor Pea3 favors EMT and contributes to tumorigenesis via a negative regulatory loop with Cyclin D2, a new Pea3 target gene.
23591848 SUMO modification of ATF3 influences CCND1/2 activity and cellular proliferation of prostate cancer PC3 and DU145 cells and explains at least in part how ATF3 functions to regulate cancer development.
23466356 Cyclin D2 is a direct target of miR-206 in breast cancer cells
23428540 miR-154 plays a prominent role in prostate cancer proliferation by suppressing CCND2
23348698 miR-206 could suppress gastric carcinoma cell proliferation at least partially through targeting cyclinD2 expression.
23266556 CCND2 gene polymorphism is associated in the pathogenesis of colorectal cancers.
23255553 Chromosomal rearrangements of the CCND2 locus were detected in 55% of the cases, with an IG gene as partner in 18 of 22, in particular with light chains (10 IGK@ and 5 IGL@)for mantle cell lymphoma.
22964630 our results demonstrate that cyclin D2 has a critical role in cell cycle progression and the tumorigenicity of glioblastoma stem cells
22954617 Experimental verification of the ability of this small RNA molecule to regulate the expression of CCND2, a gene with documented oncogenic activity, confirms its functional role as a miRNA.
22853316 Transgenic K562 cells have distinct gene expression profiles both in steady state and during terminal erythroid differentiation, with GATA1s expression characterised by lack of repression of MYB, CCND2 and SKI.
22848417 miR-182, a p53 dependent miRNA, suppressed the expression of MITF, BCL2, cyclin D2 and functioned as a potent tumor suppressor in uveal melanoma cells.
22534667 The present study suggests that reduced expression of cyclin D2 in stage III NSCLC may be associated with poor RFS. And, cyclin D2 may have a distinct role from cyclin D1 in NSCLC.
22395070 The authors demonstrate that Cyclin D2 is also expressed in the developing human cortex within similar domains, thus indicating that its role as a fate determinant is ancient and conserved.
22330340 Downregulation of miR-1, -206 and -29 stabilizes the expression of PAX3 and CCND2 in both embryonal and alveolar rhabdomyosarcoma.
22323446 FBXL2 targets cyclin D2 for ubiquitination and degradation to inhibit leukemic cell proliferation.
22048254 CCND2, was the most "dietary sensitive" genes, as methylation of their promoters was associated with intakes of at least two out of the eight dietary methyl factors examined.
22004425 Single nucleotide polymorphisms of CCND2, RAD23B, GRP78, CEP164, MDM2, and ALDH2 genes were significantly associated with development and recurrence of hepatocellular carcinoma in Japanese patients with hepatitis C virus.
21878650 ethanol-induced neuronal apoptosis follows both the mitochondria-mediated (miR-497- and BCL2-mediated) and non-mitochondria-mediated (miR-302b- and CCND2-mediated) pathway.
21790895 Cyclin D2 is overexpressed in the proliferation centers of CLL/SLL and this is due, in part, to the upregulation of NF-kappaB-related pathways.
21745168 Data show that combination of siRNA-mediated inhibition of the cyclin D1 and cyclin D2 along with chemotherapeutic agents could potentially be used to lower the effective doses of the chemotherapeutic agents and reduce drug-related toxicities.
21521747 Major regulator of CCND2 expression in pancreatic beta cells is glucose acting via glycolysis and calcium channels; glucose up-regulates nuclear CCND2 in quiescent cells and down-regulates CCND2 in replicating cells.
21504716 Authors present a CD5-positive, CCND1-negative B-cell lymphoma with a novel translocation involving CCND2 and the immunoglobulin lambda (IGL) gene.
21479697 High expression of cyclin D2 is associated with mantle cell lymphoma.
21059263 sonic hedgehog-GLI1 downstream target genes PTCH1, Cyclin D2, Plakoglobin, PAX6 and NKX2.2 are differently regulated in medulloblastoma and astrocytoma
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21039844 Our result supported the finding that ubiquitin-specific protease 22 can interact with cyclin D2 and active cyclin D2 activity.
20939487 Zinc can accelerate the proliferation and DNA reproduction of cord blood-derived mesenchymal stem cells and increase the contents of cyclin D2, CDK4, and cellular total protein.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20473882 High level of CCND2 expression is associated with nasopharyngeal carcinoma.
20418948 the 3'UTR of E2F2 and CCND2 were directly bound to let-7a and let-7a down-regulated the expression of E2F2 and CCND2, suppressing prostate cancer cell proliferation in culture
20414251 One common polymorphism in the 5'-untranslated region (that is, rs1049606) and the most common haplotype (CCND-ht1 [T-C-T-A-T]), however, were significantly associated with hepatatis B virus clearance.
20414251 Observational study of gene-disease association. (HuGE Navigator)
20077038 High cyclin D2 is associated with higher grade (III and IV) of astrocytoma.
20066902 cyclin D2+ cells represent a pool of leukemic cells with the potential to enter the dividing compartment.
19945765 hypermethylation in tumors from non-small cell lung cancer patients is associated with gender and histologic type
19890848 Cyclin D2 and the CDK substrate p220(NPAT) are required for self-renewal of human embryonic stem cells.
19738611 Observational study of gene-disease association. (HuGE Navigator)
19679881 the knockdown of cyclin D1 is compensated by the upregulation of cyclin D2, a more powerful strategy would be to inhibit both cyclin D1 and cyclin D2.
19641124 data presented here indicate that cD2 is not necessary for cortical intermediate progenitor cells (IPCs) to emerge but that cD2 is used in progenitors as they transition into and expand their IPC numbers
19618401 Data show that methylation of CCND-2, p16, RAR-beta and RASSF-1a was significantly more prevalent in tumor than in normal tissue specimens.
19608671 As a result of the mantle cell lymphoma translocation, cycD2 mRNA was highly over-expressed when compared with normal lymphoid tissue and other B-cell non-Hodgkin's lymphomas
19577536 restoration of CCND2 expression potentially prevents the carcinogenesis of prostate cancer, which is mostly androgen receptor -dependent in the initial settings.
19508551 In colorectal adenocarcinoma expression of cyclin D2 at the margin was associated with vascular invasion, lymph node metastasis and liver metastasis
19464003 study suggests that downstream signaling components of the PI3K/Akt pathway, GSK3 & cyclin D2 as well as the significant interaction between PTEN-PDK and between pAkt-pGSK3beta, are involved in the survival and proliferation of leiomyomas.
19379567 Valproic acid could down-regulate mRNA expression of cyclin D2 in the kasumi-1 leukemic cell line.
19258477 Observational study of gene-disease association. (HuGE Navigator)
19252133 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18930031 These results suggest that miR-302b plays an important role in maintaining the pluripotency of embryonal carcinoma cells and probably embryonic stem cells , by post-transcriptional regulation of Cyclin D2 expression.
18827403 a pattern of translocalization suggests a spatial separation of the cyclin D-Cdk complex from pRb and DNA in the nucleus to regulate the G1-S transition
18714005 in response to cellular activation in T cells and B cells, a PTB-containing stability complex forms that contains binding sites for Rab8A and cyclin D(2) transcripts and increases their mRNA half-lifes
18635970 All three D-type cyclins promoted robust hepatocyte proliferation and marked liver growth, although cyclin D3 stimulated less DNA synthesis than D1 or D2.
18507837 Observational study of gene-disease association. (HuGE Navigator)
18504428 Tax-induced cell-cycle progression in T cells is mediated, at least in part, through cell-type-specific activation of the cyclin D2 and cdk6 genes through NF-kappaB and may be important for the cell-type-specific oncogenesis.
18483325 Forty one percent of breast cancers were associated with methylation of cyclin d2.
18431519 Data demonstrate that RNA interference of genes encoding cyclin D1 and cyclin D2 (CCND1 and CCND2, respectively) inhibits proliferation and is progressively cytotoxic in human myeloma cells.
18391076 cyclin E expression in 2 t(11;14)-negative mantle cell lymphomas characterized by a cryptic t(2;14)(p24;q32) and identification of MYCN as a new lymphoma oncogene associated with a blastoid mantle cell lymphoma
18281541 Observational study of gene-disease association. (HuGE Navigator)
18174243 Observational study of gene-disease association. (HuGE Navigator)
17882269 role for D-type cyclins in the excessive basal-cell proliferation and perturbed keratinocyte differentiation in the psoriatic epidermis
17873913 Responsible for neoplastic cell transformation when coexpressed with an activated Ras protein.
17486076 cyclin D2 expression in normal and malignant hematopoietic cells is regulated by ubiquitin/proteasome-dependent degradation triggered by Thr280 phosphorylation by GSK3beta or p38, which is induced by inhibition of the PI3K pathway
17409409 Observational study of gene-disease association. (HuGE Navigator)
17016690 Cyclin D2 promoter methylation and gene silencing may play an important functional role in prostate carcinogenesis.
16548914 the recurrent T-ALL-associated t(12;14) results in overexpression of cyclin D2
15797629 This suggests that dysregulation of CCND2 and CDK4 plays a specific role in WT tumorigenesis.
15755896 Cyclin D1, D2, or D3 expression appears to be increased and/or dysregulated in virtually all MM tumors despite their low proliferative capacity
15509806 conditional activation of FoxO3a leads to accumulation of BCL6 and down-regulation of cyclin D2 at protein and mRNA levels
15245432 E2 may stimulate the growth of keratinocytes by inducing cyclin D2 expression via CREB phosphorylation by protein kinase A, dependent on cAMP.
15169570 p21/cyclin D2/cdk4 complex is not an inhibitory complex for the cyclin D2/cdk4 complex in HTLV-1 infected cells.
14612939 DNA hypomethylation is a mechanism underlying the increased expression of cyclin D2 in cancer cells and demethylation of cyclin D2 may be involved in development and progression of gastric carcinoma
14601057 hypermethylated in invasive and in in situ lobular breast cancer
14581343 methylation of Cyclin D2 in prostate cancers correlates with clinicopathological features of poor prognosis
12777997 results show that cyclin D2 is complexed with p27, leading to a model for testicular germ cell tumors whereby the overexpression of cyclin D2 leads to the functional sequestration of p27 in the presence of CCNE and CCND2, favoring cell proliferation
12771922 cyclin d2 hypermethylation associated with loss of cyclin d2 expression in subset of gastric cancer
12112307 Overexpression of cyclin D2 is associated with increased in vivo invasiveness of human squamous carcinoma cells.
11992406 Activation of cyclin D1 and D2 promoters by human T-cell leukemia virus type I tax protein is associated with IL-2-independent growth of T cells

AA Sequence

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQ      1 - 70
KCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWE     71 - 140
LVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAA    141 - 210
ICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQAST    211 - 280
PTDVRDIDL                                                                 281 - 289
//

Text Mined References (150)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26707908 2016 MicroRNA-124-3p inhibits the growth and metastasis of nasopharyngeal carcinoma cells by targeting STAT3.
26341922 2016 Post-transcriptional Modifications Contribute to the Upregulation of Cyclin D2 in Multiple Myeloma.
26290144 2015 CCND2, CTNNB1, DDX3X, GLI2, SMARCA4, MYC, MYCN, PTCH1, TP53, and MLL2 gene variants and risk of childhood medulloblastoma.
26225959 2015 miR-198 Represses the Proliferation of HaCaT Cells by Targeting Cyclin D2.
26221902 2015 miR-206 inhibits human laryngeal squamous cell carcinoma cell growth by regulation of cyclinD2.
25980436 2015 SMYD3 contributes to a more aggressive phenotype of prostate cancer and targets Cyclin D2 through H4K20me3.
25961636 2015 Analysis of DNA methylation and gene expression in radiation-resistant head and neck tumors.
25960238 2015 Prognostic significance of combined microRNA-206 and CyclinD2 in gastric cancer patients after curative surgery: A retrospective cohort study.
25824739 2015 Loss of expression of cyclin d2 by aberrant DNA methylation: a potential biomarker in vietnamese breast cancer patients.
25817794 2015 miR-340 inhibits glioblastoma cell proliferation by suppressing CDK6, cyclin-D1 and cyclin-D2.
25738424 2015 Circuit- and Diagnosis-Specific DNA Methylation Changes at ?-Aminobutyric Acid-Related Genes in Postmortem Human Hippocampus in Schizophrenia and Bipolar Disorder.
25673160 2015 OY-TES-1 may regulate the malignant behavior of liver cancer via NANOG, CD9, CCND2 and CDCA3: a bioinformatic analysis combine with RNAi and oligonucleotide microarray.
25605810 2015 Association analysis of 29,956 individuals confirms that a low-frequency variant at CCND2 halves the risk of type 2 diabetes by enhancing insulin secretion.
25572712 2015 Reduced expression of microRNA?206 regulates cell proliferation via cyclinD2 in gliomas.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25193387 2014 DNA methylation gene-based models indicating independent poor outcome in prostate cancer.
24992041 2014 Cyclin D2 plays a regulatory role in HBV replication.
24836286 2014 Large-scale genetic study in East Asians identifies six new loci associated with colorectal cancer risk.
24743557 2014 Association between the polymorphism rs3217927 of CCND2 and the risk of childhood acute lymphoblastic leukemia in a Chinese population.
24705253 2014 De novo CCND2 mutations leading to stabilization of cyclin D2 cause megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome.
24464100 2014 Identification of low-frequency and rare sequence variants associated with elevated or reduced risk of type 2 diabetes.
24249158 2014 Genome-wide analysis of DNA copy number alterations and loss of heterozygosity in intracranial germ cell tumors.
24130168 2014 Characterization of microRNA-29 family expression and investigation of their mechanistic roles in gastric cancer.
23989931 2013 Loss of a negative feedback loop involving pea3 and cyclin d2 is required for pea3-induced migration in transformed mammary epithelial cells.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23591848 2013 Loss of SUMOylation on ATF3 inhibits proliferation of prostate cancer cells by modulating CCND1/2 activity.
23466356 2013 miR-206 is down-regulated in breast cancer and inhibits cell proliferation through the up-regulation of cyclinD2.
23459443 2014 Drug-gene interactions and the search for missing heritability: a cross-sectional pharmacogenomics study of the QT interval.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23428540 2014 miR-154 inhibits prostate cancer cell proliferation by targeting CCND2.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23348698 2013 miR-206 inhibits gastric cancer proliferation in part by repressing cyclinD2.
23266556 2013 Identification of Genetic Susceptibility Loci for Colorectal Tumors in a Genome-Wide Meta-analysis.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
23255553 2013 CCND2 rearrangements are the most frequent genetic events in cyclin D1(-) mantle cell lymphoma.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22964630 2013 The critical role of cyclin D2 in cell cycle progression and tumorigenicity of glioblastoma stem cells.
22954617 2012 A new microRNA target prediction tool identifies a novel interaction of a putative miRNA with CCND2.
22853316 2012 The GATA1s isoform is normally down-regulated during terminal haematopoietic differentiation and over-expression leads to failure to repress MYB, CCND2 and SKI during erythroid differentiation of K562 cells.
22848417 2012 Role of microRNA-182 in posterior uveal melanoma: regulation of tumor development through MITF, BCL2 and cyclin D2.
22534667 2012 Reduced expression of cyclin D2 is associated with poor recurrence-free survival independent of cyclin D1 in stage III non-small cell lung cancer.
22395070 2012 Cyclin D2 in the basal process of neural progenitors is linked to non-equivalent cell fates.
22330340 2012 Downregulation of microRNAs miR-1, -206 and -29 stabilizes PAX3 and CCND2 expression in rhabdomyosarcoma.
22323446 2012 F-box protein FBXL2 targets cyclin D2 for ubiquitination and degradation to inhibit leukemic cell proliferation.
22048254 2011 The influence of one-carbon metabolism on gene promoter methylation in a population-based breast cancer study.
22004425 2012 Genetic risk of hepatocellular carcinoma in patients with hepatitis C virus: a case control study.
21878650 2011 miR-497 and miR-302b regulate ethanol-induced neuronal cell death through BCL2 protein and cyclin D2.
21790895 2011 Cyclin D2 is overexpressed in proliferation centers of chronic lymphocytic leukemia/small lymphocytic lymphoma.
21745168 2011 Small interfering RNAs targeting cyclin D1 and cyclin D2 enhance the cytotoxicity of chemotherapeutic agents in mantle cell lymphoma cell lines.
21521747 2011 Glucose regulates cyclin D2 expression in quiescent and replicating pancreatic ?-cells through glycolysis and calcium channels.
21504716 2011 CD5-positive, cyclinD1-negative mantle cell lymphoma with a translocation involving the CCND2 gene and the IGL locus.
21479697 2012 The expression of SOX11, cyclin D1, cyclin D2, and cyclin D3 in B-cell lymphocytic proliferative diseases.
21059263 2010 Regulation of sonic hedgehog-GLI1 downstream target genes PTCH1, Cyclin D2, Plakoglobin, PAX6 and NKX2.2 and their epigenetic status in medulloblastoma and astrocytoma.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21039844 2010 Increased expression of ubiquitin-specific protease 22 can promote cancer progression and predict therapy failure in human colorectal cancer.
20939487 2010 [Influences of zinc on concentrations of cyclin D2 and cyclin-dependent kinase 4 of human umbilical cord blood-derived mesenchymal stem cells].
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20473882 2011 Gene expression profile changes and possible molecular subtypes in differentiated-type nonkeratinizing nasopharyngeal carcinoma.
20418948 2010 MicroRNA let-7a inhibits proliferation of human prostate cancer cells in vitro and in vivo by targeting E2F2 and CCND2.
20414251 2010 CCND2 polymorphisms associated with clearance of HBV infection.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20077038 2011 Expression of cyclin D2, P53, Rb and ATM cell cycle genes in brain tumors.
20066902 2009 Is cyclin D2 a marker of B-cLL cell activation?
19945765 2010 DNA hypermethylation of tumors from non-small cell lung cancer (NSCLC) patients is associated with gender and histologic type.
19890848 2010 Cyclin D2 and the CDK substrate p220(NPAT) are required for self-renewal of human embryonic stem cells.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19679881 2009 The targeting of the sole cyclin D1 is not adequate for mantle cell lymphoma and myeloma therapies.
19641124 2009 Cyclin D2 is critical for intermediate progenitor cell proliferation in the embryonic cortex.
19618401 2010 Quantitative evaluation of DNA hypermethylation in malignant and benign breast tissue and fluids.
19608671 2009 Differential diagnosis of cyclin D2+ mantle cell lymphoma based on fluorescence in situ hybridization and quantitative real-time-PCR.
19577536 2009 Restoration of cyclin D2 has an inhibitory potential on the proliferation of LNCaP cells.
19508551 2010 Expression of cyclin D2 is an independent predictor of the development of hepatic metastasis in colorectal cancer.
19464003 2010 Changes related to phosphatidylinositol 3-kinase/Akt signaling in leiomyomas: possible involvement of glycogen synthase kinase 3alpha and cyclin D2 in the pathophysiology.
19379567 2009 [Reversed effect of valproic acid on transcription inhibition of AML1-ETO fusion protein of kasumi-1 leukemic cell line].
19258477 2009 Candidate gene analysis using imputed genotypes: cell cycle single-nucleotide polymorphisms and ovarian cancer risk.
19252133 2009 Interrogating type 2 diabetes genome-wide association data using a biological pathway-based approach.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19107115 2010 Genome-wide association study of recurrent major depressive disorder in two European case-control cohorts.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18930031 2008 miR-302b maintains "stemness" of human embryonal carcinoma cells by post-transcriptional regulation of Cyclin D2 expression.
18827403 2008 Migratory localization of cyclin D2-Cdk4 complex suggests a spatial regulation of the G1-S transition.
18714005 2008 A polypyrimidine tract-binding protein-dependent pathway of mRNA stability initiates with CpG activation of primary B cells.
18635970 2008 Distinct proliferative and transcriptional effects of the D-type cyclins in vivo.
18507837 2008 Effects of common germline genetic variation in cell cycle control genes on breast cancer survival: results from a population-based cohort.
18504428 2008 Activation of the cyclin D2 and cdk6 genes through NF-kappaB is critical for cell-cycle progression induced by HTLV-I Tax.
18483325 2008 DNA methylation in benign breast epithelium in relation to age and breast cancer risk.
18431519 2008 Identification of kinetin riboside as a repressor of CCND1 and CCND2 with preclinical antimyeloma activity.
18391076 2008 Translocations targeting CCND2, CCND3, and MYCN do occur in t(11;14)-negative mantle cell lymphomas.
18281541 2008 Effects of common germ-line genetic variation in cell cycle genes on ovarian cancer survival.
18174243 2008 Association of single-nucleotide polymorphisms in the cell cycle genes with breast cancer in the British population.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17882269 2008 Differential expression of D-type cyclins in HaCaT keratinocytes and in psoriasis.
17873913 2008 Human and mouse cyclin D2 splice variants: transforming activity and subcellular localization.
17486076 2007 Glycogen synthase kinase-3beta and p38 phosphorylate cyclin D2 on Thr280 to trigger its ubiquitin/proteasome-dependent degradation in hematopoietic cells.
17409409 2007 Tagging single nucleotide polymorphisms in cell cycle control genes and susceptibility to invasive epithelial ovarian cancer.
17016690 2006 Hypermethylation of Cyclin D2 is associated with loss of mRNA expression and tumor development in prostate cancer.
16765349 2006 Increased p21 expression and complex formation with cyclin E/CDK2 in retinoid-induced pre-B lymphoma cell apoptosis.
16548914 2006 Deregulation of cyclin D2 by juxtaposition with T-cell receptor alpha/delta locus in t(12;14)(p13;q11)-positive childhood T-cell acute lymphoblastic leukemia.
16541075 2006 The finished DNA sequence of human chromosome 12.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16182291 2005 The polycomb group gene product Mel-18 interacts with cyclin D2 and modulates its activity.
15797629 2005 Frequent overexpression of cyclin D2/cyclin-dependent kinase 4 in Wilms' tumor.
15755896 2005 Cyclin D dysregulation: an early and unifying pathogenic event in multiple myeloma.
15613482 2005 Induction of cyclin D2 in rat granulosa cells requires FSH-dependent relief from FOXO1 repression coupled with positive signals from Smad.
15509806 2004 FoxO3a and BCR-ABL regulate cyclin D2 transcription through a STAT5/BCL6-dependent mechanism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15245432 2004 17beta-estradiol stimulates the growth of human keratinocytes by inducing cyclin D2 expression.
15169570 2004 The role of cyclin D2 and p21/waf1 in human T-cell leukemia virus type 1 infected cells.
15065884 2004 The nuclear protein p34SEI-1 regulates the kinase activity of cyclin-dependent kinase 4 in a concentration-dependent manner.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14641107 2004 A novel partner for D-type cyclins: protein kinase A-anchoring protein AKAP95.
14612939 2003 Promoter methylation of cyclin D2 gene in gastric carcinoma.
14601057 2003 DNA methylation of RASSF1A, HIN-1, RAR-beta, Cyclin D2 and Twist in in situ and invasive lobular breast carcinoma.
14581343 2003 Inactivation of cyclin D2 gene in prostate cancers by aberrant promoter methylation.
12777997 2003 p27 and cyclin E/D2 associations in testicular germ cell tumors: implications for tumorigenesis.
12771922 2003 Absence of cyclin D2 expression is associated with promoter hypermethylation in gastric cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12112307 2002 Overexpression of cyclin D2 is associated with increased in vivo invasiveness of human squamous carcinoma cells.
11992406 2002 Activation of cyclin D1 and D2 promoters by human T-cell leukemia virus type I tax protein is associated with IL-2-independent growth of T cells.
11896535 2002 Cell cycle progression of chronic lymphocytic leukemia cells is controlled by cyclin D2, cyclin D3, cyclin-dependent kinase (cdk) 4 and the cdk inhibitor p27.
11839508 Characterization of cyclin D2 expression in human endometrium.
11726322 2001 Cell cycle regulatory proteins and apoptosis in B-cell chronic lymphocytic leukemia.
11469683 2001 Induction and expression of cyclin D3 in human pancreatic cancer.
11358847 2001 Up-regulation of cyclin-dependent kinase 4/cyclin D2 expression but down-regulation of cyclin-dependent kinase 2/cyclin E in testicular germ cell tumors.
11301189 2001 Novel expression of cyclin-dependent kinase inhibitors in human B-cell precursors.
11289162 2001 Loss of cyclin D2 expression in the majority of breast cancers is associated with promoter hypermethylation.
11285977 2001 The expression of pseudogene cyclin D2 mRNA in the human ovary may be a novel marker for decreased ovarian function associated with the aging process.
11254678 2001 Cutting edge: differential signaling requirements for activation of assembled cyclin D3-cdk4 complexes in B-1 and B-2 lymphocyte subsets.
11209538 2000 Clinical correlation of cyclin D2 mRNA expression in human luteinized granulosa cells.
11042687 2000 NPDC-1, a regulator of neural cell proliferation and differentiation, interacts with E2F-1, reduces its binding to DNA and modulates its transcriptional activity.
10508165 1999 Direct induction of cyclin D2 by Myc contributes to cell cycle progression and sequestration of p27.
10398124 1999 D-type cyclins in adult human testis and testicular cancer: relation to cell type, proliferation, differentiation, and malignancy.
9858559 1999 Cyclin D- and E-dependent kinases and the p57(KIP2) inhibitor: cooperative interactions in vivo.
9422379 1998 Cyclin D2 interacts with cdk-5 and modulates cellular cdk-5/p35 activity.
9003781 1996 The consensus motif for phosphorylation by cyclin D1-Cdk4 is different from that for phosphorylation by cyclin A/E-Cdk2.
8945475 1996 Cyclin D2 is an FSH-responsive gene involved in gonadal cell proliferation and oncogenesis.
8887674 1996 Interaction of D-type cyclins with a novel myb-like transcription factor, DMP1.
8621559 1996 Functional analysis of the human cyclin D2 and cyclin D3 promoters.
8455931 1993 Cyclins D1 and D2 are differentially expressed in human B-lymphoid cell lines.
8343202 1993 Functional interactions of the retinoblastoma protein with mammalian D-type cyclins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8114739 1994 Identification of G1 kinase activity for cdk6, a novel cyclin D partner.
7739547 1995 Novel INK4 proteins, p19 and p18, are specific inhibitors of the cyclin D-dependent kinases CDK4 and CDK6.
1386336 1992 Molecular cloning and chromosomal mapping of CCND genes encoding human D-type cyclins.
1386335 1992 Genomic organization, chromosomal localization, and independent expression of human cyclin D genes.