Tchem | G1/S-specific cyclin-D1 |
Regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D1/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. Exhibits transcriptional corepressor activity with INSM1 on the NEUROD1 and INS promoters in a cell cycle-independent manner.
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis. [provided by RefSeq, Jul 2008]
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. This protein has been shown to interact with tumor suppressor protein Rb and the expression of this gene is regulated positively by Rb. Mutations, amplification and overexpression of this gene, which alters cell cycle progression, are observed frequently in a variety of tumors and may contribute to tumorigenesis. [provided by RefSeq, Jul 2008]
Comments
Property Summary
Ligand Count | 2 |
NCBI Gene PubMed Count | 1,283 |
PubMed Score | 5737.32 |
PubTator Score | 4570.69 |
Disease | Target Count | P-value |
---|---|---|
astrocytoma | 1146 | 1.8e-09 |
Astrocytoma, Pilocytic | 3081 | 8.5e-09 |
ependymoma | 4679 | 2.0e-07 |
psoriasis | 6694 | 3.0e-07 |
oligodendroglioma | 2850 | 3.5e-06 |
malignant mesothelioma | 3232 | 2.0e-05 |
colon cancer | 1478 | 1.7e-04 |
pituitary cancer | 1972 | 2.3e-04 |
cystic fibrosis | 1696 | 2.5e-04 |
glioblastoma | 5792 | 5.9e-04 |
atypical teratoid / rhabdoid tumor | 5112 | 1.8e-03 |
medulloblastoma, large-cell | 6241 | 2.0e-03 |
adult high grade glioma | 3801 | 2.6e-03 |
ovarian cancer | 8520 | 3.0e-03 |
osteosarcoma | 7950 | 3.9e-03 |
group 3 medulloblastoma | 4104 | 6.0e-03 |
lung cancer | 4740 | 9.4e-03 |
subependymal giant cell astrocytoma | 2287 | 1.5e-02 |
primitive neuroectodermal tumor | 3035 | 2.0e-02 |
Hydrolethalus syndrome | 128 | 3.7e-02 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Endometrial cancer | 311 | 0.0 | 0.5 |
Immune system cancer | 140 | 0.0 | 0.7 |
Lymphoid leukemia | 160 | 0.0 | 0.7 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Breast cancer | 3578 | 0.0 | 0.00373686301306713 |
Kidney cancer | 2613 | 0.0 | 1.4 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Adenoma | 167 | 4.628 | 2.3 |
ductal carcinoma in situ | 1745 | 3.674 | 1.8 |
Gastrointestinal system disease | 54 | 3.514 | 1.8 |
Vascular disease | 319 | 3.41 | 1.7 |
Parathyroid Adenoma | 19 | 3.275 | 1.6 |
Intestinal benign neoplasm | 12 | 3.214 | 1.6 |
Familial adenomatous polyposis | 32 | 3.185 | 1.6 |
Primary hyperparathyroidism | 5 | 3.077 | 1.5 |
Disease | log2 FC | p |
---|---|---|
Breast cancer | 1.100 | 3.7e-03 |
adult high grade glioma | 1.300 | 2.6e-03 |
astrocytoma | 1.200 | 1.8e-09 |
Astrocytoma, Pilocytic | 2.100 | 8.5e-09 |
atypical teratoid / rhabdoid tumor | 2.300 | 1.8e-03 |
colon cancer | 1.400 | 1.7e-04 |
cystic fibrosis | 1.148 | 2.5e-04 |
ependymoma | 2.200 | 2.0e-07 |
glioblastoma | 1.700 | 5.9e-04 |
group 3 medulloblastoma | -1.300 | 6.0e-03 |
Hydrolethalus syndrome | 1.674 | 3.7e-02 |
lung cancer | 1.100 | 9.4e-03 |
malignant mesothelioma | -1.600 | 2.0e-05 |
medulloblastoma, large-cell | -1.100 | 2.0e-03 |
oligodendroglioma | 1.300 | 3.5e-06 |
osteosarcoma | 2.559 | 3.9e-03 |
ovarian cancer | 1.400 | 3.0e-03 |
pituitary cancer | 1.100 | 2.3e-04 |
primitive neuroectodermal tumor | 2.000 | 2.0e-02 |
psoriasis | -1.500 | 3.0e-07 |
subependymal giant cell astrocytoma | 1.432 | 1.5e-02 |
Species | Source | Disease |
---|---|---|
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG | ||
Inparanoid OMA EggNOG |
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEE 1 - 70 QKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQM 71 - 140 ELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVA 141 - 210 AVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEE 211 - 280 VDLACTPTDVRDVDI 281 - 295 //