Property Summary

NCBI Gene PubMed Count 1,189
PubMed Score 5447.09
PubTator Score 4570.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 2.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 7.551 3.8

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma -1.600 2.0e-05
psoriasis -1.500 3.0e-07
astrocytoma 1.200 1.8e-09
oligodendroglioma 1.300 3.5e-06
osteosarcoma 2.559 3.9e-03
ependymoma 2.500 9.6e-10
glioblastoma 2.300 1.0e-03
cystic fibrosis 1.148 2.5e-04
atypical teratoid/rhabdoid tumor 2.400 1.3e-05
medulloblastoma, large-cell -1.100 2.0e-03
primitive neuroectodermal tumor 2.000 2.0e-02
Hydrolethalus syndrome 1.674 3.7e-02
lung cancer 1.300 5.1e-04
colon cancer 1.700 3.5e-06
pediatric high grade glioma 2.300 1.2e-05
group 4 medulloblastoma -1.700 2.7e-04
pilocytic astrocytoma 2.700 7.6e-13
subependymal giant cell astrocytoma 1.432 1.5e-02
Breast cancer 1.100 3.7e-03
ovarian cancer 3.300 2.2e-07
pituitary cancer 1.100 2.3e-04

Gene RIF (1164)

PMID Text
27025456 Data show that the fusion gene cyclin D1/myotonic dystrophy kinase-related CDC42-binding protein kinase alpha (CCND1/MRCK) mRNA is resistant to CCND1-targeted miRNA regulation.
26997441 BRAF inhibitor therapy-associated melanocytic lesions lack the BRAF V600E mutation and show increased levels of cyclin D1 expression.
26884359 Analysis of ctal carcinoma in situ (DCIS) by grade suggested that two independent SNPs near CCND1 were specific to low/intermediate grade DCIS . These associations with grade remained after adjusting for ER status and were also found in IDC
26834014 Together, these results demonstrate that PGC-1alpha regulates cell cycle progression through modulation of CyclinD1 and CyclinB1 by ATP and ROS.
26815661 The expressions of survivin and cycline D1 are positively correlated with the malignant potential of mucinous ovarian neoplasms.
26791264 Data indicated that HOXA1 and CCND1 mRNA and protein expression were higher in gastric cancer (GC) tissues, that a significant correlation was found between their expression, and they both may serve as a novel prognostic biomarker for GC.
26728382 Data show that Cyclin D1 has a higher expression in breast cancer, positively correlated with estrogen receptors (ER) and better prognosis.
26708419 This inhibition was accompanied by a strong decrease in G1 cyclins (particularly in cyclin D1) and retinoblastoma protein (Rb) phosphorylation
26708311 All of the results confirmed that CD73 promotes the growth of human colorectal cancer cells through EGFR and the b-catenin/cyclin D1 signaling pathway. CD73 may be used as a valuable biomarker of colorectal cancer.
26707131 The potent antitumor activity of RHL may be mediated through downregulation of Bcl-2 and cyclin D expression and upregulation of BAX and Bim expression.
26681199 Study suggests that cyclin D1 may be an independent prognostic factor for recurrence-free survival in stage II-IIIA adenocarcinoma of lung.
26530115 FH535 suppressed the proliferation of HCC cells by downregulating the expression of cyclin D1 and by inducing apoptosis
26510683 Neuroblastoma is associated to significantly higher levels of cyclin D1 as compared to both ganglioneuroma and ganglioneuroblastoma.
26497080 Results confirm that CEACAM6 promoted cell proliferation mediated by cyclin D1/CDK4.
26416848 Data indicate that 2-Chloroadenosine reduced levels of cyclin D1, a key G1 cyclin that controls cell-cycle progression.
26416047 showed that CCND1 and CDK4 mutations are associated with an increased risk of breast cancer
26363896 There is a significant upregulation of cyclin D1 in Ewing's sarcoma as compared to normal tissues.
26352175 Downregulation of microRNA33a promotes the expression CDK6, CCND1, and PIM1, and gastric cancer cell proliferation.
26344002 Both fenhexamid and cyprodinil may increase cancer cell proliferation by stimulating the protein expressions of cyclin D1 and cyclin E.
26337082 Ewing sarcoma cells require CDK4 and cyclin D1 for survival and anchorage-independent growth.
26261659 Case Report: IGH-CCND1 negative mantel cell lymphoma with t(12;14)(p13;q32).
26253946 RNAi-mediated silencing of Anxa2 inhibits breast cancer cell proliferation by downregulating cyclin D1 in STAT3-dependent pathway.
26247679 CREB activation may contribute to the induction of Ccnd1 expression through binding to the Ca/CRE element in the Ccnd1 gene promoter.
26246306 Cyclin D1 loss identifies prostate tumors with small-cell differentiation and may identify a small subset of adenocarcinomas with poor prognosis.
26233522 It is a marker of oligodendrocyte precursor cells in oligodendroglial tumors.
26206533 same down-regulation of cohesin targets is observed in SMC1A-mutated patient fibroblasts
26200099 Describe microcystic stromal tumor as a distinctive ovarian sex cord-stromal neoplasm characterized by FOXL2, SF-1, WT-1, Cyclin D1, and beta-catenin nuclear expression and CTNNB1 mutations.
26172301 mechanistic study of the molecular interactions between antizyme inhibitor and its interacting proteins CCND1 and ornithine decarboxylase
26151768 In G28 cells, a dosedependent induction of CDK2, p21 and cyclin D was observed between 10 and 50 microM roscovitine after 72 h, however, at the highest concentration of 100 microM, all investigated genes were downregulated.
26150472 CCND1-CDK4-mediated cell cycle progression provides a competitive advantage for human hematopoietic stem cells in vivo.
26137545 Cyclin D1 Again Caught in the Act: Dyrk1a Links G1 and Neurogenesis in Down Syndrome.
26133979 ZIP5 knockdown inhibited the proliferation, migration and invasion of ESCC and suppressed COX2, cyclin D1 and E-cadherin expression, which led to the inhibition of cell progression in esophageal squamous cell carcinoma .
26129688 our data demonstrate that miR-193b targets cyclin D1 in prostate cancer.
26125784 Our results suggest that the CCND1 G870A SNP may be critically involved in multiple myeloma development
26125710 The findings suggest that heritable CCND1 status may influence the risk of developing leukemia and hepatocellular carcinoma, and that more attention should be given to carriers of these susceptibility genes. (Meta-analysis)
26124325 A statistically significant lapatinib- and gefitinib-induced repression of cyclin D1, MMP9 and beta-catenin in CERV196 cells.
26121043 the anti-proliferative effect of resibufogenin may be attributed to the degradation of cyclin D1 caused by the activation of GSK-3beta
26111591 Marine steroids as potential anticancer drug candidates: In silico investigation in search of inhibitors of Bcl-2 and CDK-4/Cyclin D1.
26101806 mitotic stabilized ATF7 protein re-localizes onto chromatin at the end of telophase and contributes to induce the cyclin D1 gene expression.
26067621 DNA methylation changes in neuroblastoma affect not only promoters but also intragenic regions of the genome and target functional chromatin domains of development and cancer-related genes such as CCND1.
26055143 cyclin D1 expression cooperates with KRAS and PTEN alterations in pathogenesis of NSCLC, and they could serve as potential multiple molecular markers for specific subgroups of NSCLC patients as well as prognostic markers for this type of cancer.
26055066 cyclin-D1 and cyclin-D3 within human islet cells varies according to the status of the pancreas donor
26047605 Overexpression of miR-503 in breast cancer cell lines reduced cell proliferation through inducing G0/G1 cell cycle arrest by targeting CCND1
25998224 knockdown of ILK inhibits glioma cell migration, invasion and proliferation through upregulation of E-cadherin and downregulation of cyclin D1. Our results suggest that ILK may serve as a promising therapeutic target for glioma.
25991665 Nuclear EGFR occurs in ameloblastomas in association with Cyclin D1 expression
25985117 miR-19a/Cyclin D1 axis might have promising applications as a therapeutic target and a prognostic marker for patients with hepatocellular carcinoma.
25971210 Ectopic cyclin D1 reversed miR-95-3p-mediated inhibition of invasiveness and clonogenicity, demonstrating cyclin D1 downregulation is involved in function of miR-95-3p.
25940700 Testing the oncogenic potential of catalytically inactive human cyclin D1 transduced in an in vivo knockout mouse model shows that the CDK-activating function of cyclin D1 is not necessary to induce either chromosomal instability or mammary tumorigenesis.
25939703 JARID2 inhibits leukemia cell proliferation by regulating CCND1 expression
25925673 cyclin D1 and p27 have roles in statin-induced anti-proliferative effects in breast cancer
25907675 Report cyclin D1 expression in well differentiated thyroid tumors of uncertain malignant potential.
25889927 MiR-211 is a tumor suppressor that controls expression of Cyclin D1 and CDK6.
25888980 CCND1 A870G polymorphism is not associated with prostate cancer risk.
25881299 The endoplasmic reticulum is well known to be a crucial regulator of plasma cell death and it plays the same role in their malignant counterparts, myeloma cells. This role involves activation of the UPR controlled at least in part by cyclin D1.
25879784 Data identified a subgroup of luminal-like breast cancer patients with a high risk of relapse and death harboring a combination of altered PPP2R2A and high CCND1 expression.
25869879 the high expression of TC1 was common in oral tongue squamous cell carcinomas and correlated with the expression of b-catenin and cyclin D1 and the progression of oral tongue squamous cell carcinomas
25851350 Both cyclins D1a and D1b could promote cell proliferation, which might contribute to the potential oncogenic role of cyclin D1 variants during the precancerous cirrhotic stage of hepatocarcinogenesis
25823925 CCND1 was identified as the target gene of miR-195, which functions as a osteosarcoma metastasis suppressor gene by down-regulating CCND1.
25817794 that re-introducing CDK6, cyclin-D1 or cyclin-D2 expression partially, but significantly, rescues cells from the suppression of cell proliferation and cell cycle arrest mediated by miR-340
25809706 These findings support the concept that the cell cycle regulation may play a role in colorectal cancer initiation and development and CCND1 A870G genotyping maybe a feasible technology for colorectal cancer early detection
25787974 Collectively, these data are the first to define the consequence of cyclin D1b expression on normal cellular function and present evidence for cyclin D1b as an oncogene.
25779425 Enterovirus 71 regulated the host SHSY5Y cell cycle and cell proliferation via stimulating endogenous miRNA let7b and directly targeting CCND1.
25765113 results indicate that CD1 expression in childhood peripheral neuroblastic tumors recapitulates the changes during normal development of PSNS
25765111 Notably cyclin D1 was strongly and diffusely expressed in all cases (20/20) of EWS/pPNET, while it was lacked in all cases (15/15) of rhabdomyosarcomas
25751590 Cyclin D1 immunohistochemistry can be used in the differential diagnosis of clear cell sarcomas of the kidney.
25744732 Diclofenac and curcumin overcome these carcinogenic effects by downregulating telomerase activity, diminishing the expression of TERT, CDK4, CDK2, cyclin D1, and cyclin E.
25712050 This HBx-induced cyclin D1 upregulation might play an important role in Hepatocellular carcinoma development and progression.
25702703 Data show that increased p53, together with deceased cyclin D1 and endoribonuclease DICER1 in mammospheres were responsible for microRNA let-7 inhibition.
25663615 both amplification of CCND1 and protein overexpression of cyclin D1 significantly correlate with lymph node metastasis in oral squamous cell carcinoma
25659037 WWOX inhibits prostate cancer progression through negatively regulating cyclin D1 in cell cycle lead to G1 arrest.
25645517 The increased expression of GSK3beta correlated positively with cyclin D1 and p53 expression.
25596256 The coexistence of IGH-CCND1 and IGH-BCL6 rearrangements suggest that BCL6 and cyclin D1 may cooperate in the pathogenesis of DLBCL.
25556515 evaluated the utility of cyclin D1 immunohistochemistry in identifying clear cell sarcoma of the kidney and helping to differentiate it from its mimics
25556372 Study identified the down-regulation of miR-576-3p in bladder cancer cell lines and reported that miR-576-3p, as a potential tumor suppressor in bladder cancer cells by targeting CCND1.
25550842 STAT3 and cyclinD1 correlate with more aggressive tumor behavior in esophageal squamous cell carcinoma. When STAT3 and cyclinD1 are considered together, they serve as effective prognostic markers in patients with surgically resected ESCC.
25511212 increased expression of Cyclin D1 and Ki-67 in patients with endometrial carcinoma relative to proliferative endometrium and simple hyperplasia,.. Cyclin D1 expression had a positive correlation with Ki-67 expression.
25502086 results indicate that high cyclin D1 expression is associated with a poor outcome of meningioma patients
25501285 Expression of cycle marker cyclin D1 differs between benign and malignant papillary breast lesions.
25486477 cyclin D1 and CDK4 protein interaction network was constructed in a human breast cancer cell line MCF7, and identified novel CDK4 protein partners.
25470788 High CCND1 expression is associated with pancreatic cancer.
25452171 CCND1 may be used as a prognostic biomarker for patients with resected gastric adenocarcinoma
25450356 In summary, this study suggested that miR-383 plays the role of tumor suppressor by targeting CCND1 in glioma cells, and may be useful for developing a new therapeutic strategy for gliomas.
25437003 Gene silencing of cyclin D1 leads to inhibition of the growth of head and neck squamous cell carcinoma cells.
25409185 Results from case-control study and meta-analysis suggested a significant association between the CCND1 G870A polymorphism and nasopharyngeal carcinoma risk in Chinese and Caucasians.
25399071 Our meta-analysis provides an estimate that the presence of cyclin D1 polymorphism may not confer susceptibility to breast cancer.
25358426 Bcl1 polymorphism may be one of the genetic factors in predicting treatment response to SSRI but not SNRI in Japanese patients with depression.
25339094 Lefty1 could regulates the cell cycle via modulating the expressions of P57 and cyclin D1 and then inhibit the decidualization in vitro.
25337233 Data suggest that RKIP inhibits gastric cancer metastasis via the downregulation of its downstream target genes STAT3 and cyclin D1.
25322986 Immunohistochemical staining for DACH1, PCNA and cyclin D1 was performed on human renal tissue microarrays and correlation with clinic-pathological characteristics was analyzed.
25313758 Cyclin D1 expression was seen in 67.5% of ductal carcinoma and it showed a significant correlation with ER, PgR expression (92% in this study).
25231129 SGC7901 cells with high levels of ER-a36 expression exhibited estrogen hypersensitivity, high growth rate and high levels of Cyclin D1 expression while SGC7901 cells with knocked-down levels of ER-a36 expression were insensitive to estrogen stimulation
25227811 The CCND1 G870A polymorphism may contribute to the susceptibility to papillary thyroid cancer, especially in those who were older subjects (45 </= years old) and female, in the Turkish population.
25202078 CCND1 A870G genotypes, synergistically interacted with personal cigarette smoking habit and may increase the personal risk to gastric carcinogenesis in Taiwan.
25193465 Suggest a role for cyclin D1b as a possible mediator of alphavbeta3 transcription to promote breast tumor metastasis.
25169547 CCND1 G870A polymorphism may increase risk of non-Hodgkin lymphoma, but not leukemia.
25146682 CCND1 870G/A and CDH1 -160C/A SNPs may contribute to the etiology of colorectal cancer in South Indian population and carriers of the 870A/-160A haplotype have a higher risk for colorectal cancer susceptibility.
25142862 PSAT1 expression positively correlates with the levels of phosphorylated cyclin D1 in non-small cell lung cancer.
25135222 TIP30-induced downregulation of cyclin D1 transcription antagonizes EGFR signaling and suppresses tumorigenesis
25128069 OCT4 is the upstream factor that directly binds to the CCND1 promoter to regulate CCND1 expression, then to promote cell cycle progression and accelerate the proliferation and invasion of esophageal cancer cells
25120779 the present study indicates anti-tumor effects of cyclin D1b in cervical cancer
25120774 elevated protein expression of p53, cyclin D1 and Ki-67 in the second primary malignancy is an indicator of more aggressive malignant behavior of the secondary tumor
25106503 The expressions of HER-2/neu (c-erbB2), survivin and cycline D1 are positively correlated with the malignant potential of serous ovarian neoplasms.
25081680 while there was overall a lack of any association between CCND1 polymorphisms (G870A and G1722C) and head and neck cancer (HNC) risk, smokers carrying the A allele and AA genotype of the CCND1 G870A polymorphism may be susceptible to HNC development.
25073953 A role of Notch1 signaling in activation of Cyclin D1-mediated cell proliferation in colon cancer.
25053516 cyclin D1 overexpression and possibly p16 loss of expression in pancreatic adenocarcinoma seem to be adverse prognostic factors
25022375 High Cyclin-D1 expression is correlated with significantly lower survival in oral squamous cell carcinoma patients.
25017118 GALR2-dependent activation of ERK1/2 is associated with cyclin D1 regulation but not with induction of apoptosis in head and neck squamous cell carcinoma cells.
25015333 Expression of miR-34a was lower in metastases than in primary tumors. It inversely correlated with expression of cyclin D1 and Ki-67
24995320 miR-15b may function as a glioma suppressor by targeting the Cyclin D1, which may provide a novel therapeutic strategy for treatment of glioma
24929480 Expression levels of CCDN1 in large gastric hyperplastic polyps did not vary significantly between patients with gastric carcinoma and those without.
24914206 The differential effects of PKCalpha and PKC on cyclin D1 accumulation are likely to contribute to the opposing tumor-suppressive and tumor-promoting activities of these PKC family members in the intestinal epithelium.
24912680 cyclin D1 and C/EBPbeta LAP1 operate in a common pathway to promote mammary epithelial cell differentiation.
24885829 Report cyclin D1 expression in association with hormone replacement therapy and oral contraceptives risk in colorectal cancer.
24885594 While frequency rates of BRAF mutations were quite identical across the different MPM lesions, a significant increase of cKIT (p<0.001) and CyclinD1 (p=0.002) amplification rates was observed between first and subsequent primary melanomas
24876129 Cyclin D has a role in activating the Rb tumor suppressor by mono-phosphorylation
24870800 CCND1 in skin cancer cells is responsible for E2F1-mediated cell proliferation.
24870765 CCND1 G870A polymorphism may increase brain tumor risk, especially for gliomas. [Meta-Analysis]
24862872 CCND1 amplification was seen in 28 of 133 (21.05 %) informative breast cancer patients. A discordant Cyclin D1 amplification status was detected in 6 out of 28 (21.43 %) amplified tumors.
24858206 High cyclin D1 expression is associated with ovarian cancer.
24840634 CCND1 G870A polymorphism is a risk factor for the development of glioma
24830723 Cyclin D1 governs an essential role in the E2-dependent DNA damage response via a novel extranuclear function.
24809775 CCND1 overexpression in non-habits associated anterior tongue carcinomas may contribute to their increased clinical aggressiveness.
24806449 DYRK1A reduced cellular Cyclin D1 levels by phosphorylation on Thr286, which is known to induce proteasomal degradation.
24792491 our results demonstrate a combined mechanism for the anti-proliferative effects of FRK by inhibiting cyclin D1 nucleus accumulation and pRb phosphorylation in glioma cells.
24780198 JunB expression was significantly increased while cyclin-D1 expression was significantly down-regulated in pre-eclampsia relative to control placental mesenchymal stromal cells.
24777966 Cyclin D1-specific CD8(+) T cells secreted TNF-alpha, IFN-gamma, and interleukin-2 (IL-2), and degranulated, indicating the presence of polyfunctional tumor-specific CD8(+) T cells in the blood of these patients with ccRCC.
24774443 Aberrant expression of both cyclin D1 and CDC6 by YB-1 over-expression may collaboratively participate in lung carcinogenesis.
24746206 Our study showed that p53, p21, and cyclin D1 are frequently overexpressed in ampullary adenocarcinoma (AA). Cyclin D1 overexpression is associated with increased risk of disease recurrence and worse survival in patients with AA after resection.
24739041 SGK3 is an androgen receptor (AR) target and induces cell proliferation through the AR-SGK3-p70S6K-cyclin D1 pathway in prostate cancer cells.
24737585 the present meta-analysis provides evidence that genotypes for the cyclin D1 (CCND1) G870A polymorphism may be not associated with genetic susceptibility of cervical cancer.
24728073 The meta-analysis results indicated that cyclin D1 is an unfavorable prognostic factor for colorectal cancer.
24722063 we characterized 2 exceptional cases of blastoid B-cell lymphomas with cyclin D1 overexpression, both bearing genetic rearrangements in the CYCLIN D1 gene locus.
24675814 Our findings indicated that cyclin D1 expression correlates with detrimental clinicopathological outcome and poor prognosis in oral squamous cell carcinoma.
24662605 GM-CSF accelerated the G1/S phase transition in EPCs by upregulating the expression of cyclins D1 and E.
24615109 Cyclin D1 and survivin may be used as molecular markers to predict the sensitivity of radiotherapy.
24610618 Cyclin D1 expression increases in gliomas.
24606123 Interaction of phosphorylated PRs with SP1 and cyclin D1 provides a mechanism for targeting transcriptionally active PRs to selected gene promoters relevant to breast cancer progression.
24583467 Cyclin D1 may represent a useful marker for monitoring long-term effects associated with exposure to low levels of radiation.
24570185 CCND1 G870A polymorphism may increase the risk of HBV-related hepatocellular carcinoma in the Chinese population.
24510244 It is thus inferred that gain in copy number of CCND1 is implicated in the molecular pathogenesis of parathyroid carcinoma.
24505359 miR-545 suppressed cell proliferation by inhibiting the expression of cyclin D1 and CDK4.
24499623 These findings may provide a novel linkage between the EGFR and STAT3 signaling pathways and the activation of cyclin D1 by LMP1 in the carcinogenesis of NPC.
24470282 High cyclin D1 expression is associated with laryngeal squamous cell carcinoma.
24469921 Treatment with HIV-Tat and morphine activates extracellular signal-regulated kinase-1/2 (ERK1/2), upregulates p53 and p21 levels, and downregulates cyclin D1 and Akt levels in human fetal brain-derived neural precursor cells
24468132 We suggest that there is an association between cyclin D1 gene amplification and disease severity, unfavorable prognosis, and increased expression of MDR1 in multiple myeloma patients.
24460344 No significant association was detected between CCDN1 G870A polymorphism and laryngeal squamous cell cancer development.
24458211 The prediction of CCND1 amplification by plasma DNA may be a new complementary clinical biomarker for recurrence in patients with superficial esophageal squamous cell carcinoma.
24452204 Nucleoli are rich in nucleolin, a potent transcription factor that we found to bind sites within the Ccnd1 gene specifically in Mantle cell lymphoma cells and to activate Ccnd1 transcription.
24448750 Urothelial bladder carcinoma displayed elevated expression for cyclin D1, VEGFA and TGFbeta1.
24440705 forced expression of miR-490-3P decreased both mRNA and protein levels of CCND1, which plays a key role in G1/S phase transition
24427347 Expression of beta-catenin and cyclinD1 may be used as predict markers for poor prognosis in Ovarian serous cancer
24425835 Celecoxib showed considerable chemoprotective effeciency against BPDE in both groups and this effect seems to be independent of COX-2 expression. No evidence for higher mutagen sensitivity in the Cyclin D1 gene was observed
24403468 cyclin D1 gene polymorphism CCND1 G870A is not associated with oral squamous cell carcinoma.
24390237 Analysis of a cyclinD1 mRNA directly implicated HuR in regulating cyclinD1 production: cyclinD1 translation increased in HuR-shuttling cells induced by AngII and declined in cells in which HuR levels were lowered by RNA interference
24352646 Asymptomatic monoclonal B-cell lymphocytosis with cyclin D1 overexpression is characterized by immune activation and driven by inflammatory cues.
24342356 SUMOylated RhoGDIalpha suppressed C-Jun/AP-1-dependent transactivation specifically via targeting MEK1/2-Erk, subsequently leading to the down-regulation of cyclin D1 expression and anti-cancer activity.
24324055 Altered expression of cyclin D1 is associated with lymph node metastasis and risk of UCB recurrence. Cyclin D1 expression may therefore have clinical value as a prognostic marker and potential therapeutic target
24292672 This study uncovers the molecular mechanism of PRMT2 regulating the expression of CCND1 in invasive ductal breast carcinoma.
24289491 These observations support hsa-miR-206 as a tumor suppressor in melanoma and identify Cyclin C, Cyclin D1, and CDK4 as miR-206 targets.
24287487 Induction of Dicer by cyclin D1 coordinates microRNA biogenesis in breast cancer.
24282282 Cyclin D1 has a role in prostate cancer that involves coordinating restraint of epithelial-mesenchymal transition and stem cell expanding gene expression
24264314 found and reviewed nine case-control studies on CCND1 G870A with a total of 6,823 subjects and seven studies on XPC Ala499Val with a total of 7,674 subjects
24248414 miR-449a could modulate cell cycle and apoptosis through regulating cyclin D1 and BCL2 expression in gastric cancer cells.
24222746 An meta-analysis provides evidence of the association between CCND1 G870A polymorphism and nasopharyngeal carcinoma risk.
24214587 the overexpression of cyclin D1 is almost always present in CIN1 of reproductive women, in which it might be considered as an additional diagnostic marker.
24186074 CCND1 G870A polymorphism might be correlated with the susceptibility of oral cancer in Asians.
24145651 Report CCND1 mutations in mammary analogue secretory carcinoma of salivary glands with high-grade transformation.
24143218 the prognostic value and the oncogenic function of NOTCH3 in gliomagenesis
24134204 DYRK1B is a novel Thr(286)-CCND1 kinase that acts independently of GSK3beta to promote CCND1 degradation.
24133584 ATF-3 is involved in the progress of laryngeal squamous cell carcinoma, and may provide clinical information for evaluation of its prognosis. The oncologic role of ATF-3 may be correlated with Cyclin D1 regulation.
24121026 T3 throid hormone enhanced the recruitment of the TRbeta1/Oct-1 complex on Octamer-transcription factor-1 site within cyclin D1 promoter.
24119401 Dosage of Dyrk1a repositions cells within a p21-CycD1 signaling map, directing each cell to either proliferate or to follow two distinct cell cycle exit pathways characterized by high or low CycD1 and p21 levels.
24107628 a novel activity for miR-206 in skeletal muscle differentiation. Cyclin D1 is identified as a major target that further strengthens the tumor suppressor function proposed for miR-206.
24088803 Matrine markedly suppresses cell proliferation in rhabdomyosarcoma cells by decreasing expression of cyclin D1 mRNA and blocking the cell cycle at the G0 / G1 stage.
24065533 The results suggested that HBZ suppressed cyclin D1 transcription through interactions with CREB.
24060591 CCND1 showed 2.5-3.5 log reduction after chemotherapy and increase at relapse
24038789 SDF1 exerts a quiescent effect on resident c-kit(+) CSPCs by decreasing CK1alpha levels, increasing GSK3b activity, stabilizing b-catenin, and affecting regulation of the cell cycle through Bmi-1 and cyclin D1.
24008375 Treatment with metformin upregulated the expression of p21CIP and p27KIP, but downregulated cyclin D1 levels, both in vitro and in vivo
23991964 High CCND1 expression is associated with bladder cancer.
23991960 Cyclin D1 gene G870A variants are associated with primary brain tumors.
23985254 The genetic polymorphism of CCND1 A870G might be a potential biomarker for predicting acute AEs in postoperative stage II and III rectal cancer patients treated with adjuvant concurrent chemoradiotherapy of capecitabine and oxaliplatin.
23981302 miR-21 controlled the expression of cyclin D1 through NFkappaB-dependent transcription in renal cancer cells.
23975835 Cyclin D1b expression plays a role in a part of human colorectal carcinogenesis.
23949314 As2O3 induced dose-dependent and time-dependent increases in apoptosis accompanied by cyclin D1 suppression.
23947899 Cyclin D1 was up-regulated in endometrial lesions but lacks specificity to differentiated non-neoplastic and neoplastic endometrial tissues.
23938323 This study reveals a pivotal role of combined Dmp1 loss and cyclin D1 overexpression in breast cancer.
23936312 WT1 is an oncogene and promotes NSCLC cell proliferation by up-regulating Cyclin D1 and p-pRb expression
23928935 Neither cyclin D1 nor beta-catenin was expressed in a statistically significant manner, concluding that the development of MCCs is independent of beta-catenin and cyclin D1 expression and these proteins are not suitable as prognostic markers.
23920145 Exposure of cells to excessive H2O2 induced ubiquitin-dependent proteasomal degradation of cyclin D1.
23898488 Thus, the results show that CCND1 gene polymorphism may be a predictor for detecting patients with poor survival who having metastatic disease.
23897809 cyclin D1 has a role in promoting cell cycle progression by enhancing NDR1/2 kinase activity independent of Cdk4
23893383 G870A polymorphism most likely contributes to increased susceptibility to bladder cancer in the overall population, hospital-based case-control studies, and Asians.
23887292 CCND1 amplification status and CyclinD1 expression are independent risk factors in metastasizing bladder cancer. High nuclear CyclinD1 expression in lymph node metastases predicts favorable response to chemotherapy.
23873109 Studies suggest that Cyclin D1 (CCND1) G870A polymorphism may be a risk factor for lung cancer.
23864650 Cyclin D1 mediates the convergence of ERalpha and growth factor signaling at a common cis-element of growth factor genes.
23861098 Findings suggest that aluminum concentration does not affect genomic stability of ERBB2, C-MYC, and CCND1 genes in breast tissues.
23852369 hyperelevated cyclin D1, a marker of hyperactivation of senescent cells, did not necessarily determine other markers of senescence. inhibition of MEK was sufficient to eliminate cyclin D1, regardless of MTOR.
23839043 Cyclin D1 and CDK4/6 have alternate roles in regulation of migration and cancer stem-like cell activity.
23839032 Localization of CycD1 in the cytoplasm during skin differentiation could be related to the changes in detachment ability of keratinocytes committed to differentiation.
23812426 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
23804702 Results suggest that cyclin G1-induced liver tumor-initiating cells expansion contributes to the recurrence and chemoresistance of hepatoma, and may be a promising biomarker for individualized therapy of hepatocellular carcinoma patients.
23803020 The positive relation observed between tumor metastasis and cyclinD1 expression and p16 with nodal metastasis suggested that higher cyclin D1/p16 expression may act as a predictive biomarker for aggressive behavior of gallbladder malignancies.
23795354 Co-amplification of these candidate genes or the CCND1 amplification along with either BRAF or NRAS mutations might be more important for prognosis than the presence of these alterations alone.
23794242 Our results identify for the first time the downstream targets of insulin, cyclin D1, and BAD, elucidate a new molecular mechanism of insulin in promoting cell proliferation and apoptosis
23786849 Thus, our findings highlight the cyclin D1/p21 signaling axis as a critical regulator of TGFb-mediated tumor growth initiation and local tumor cell invasion, both in vitro and in vivo.
23741361 UBE2D3 participates in the process of radiosensitivity in human breast cancer cells by regulating TERT and cyclin D1.
23737530 Data indicate that depletion of NFATc1, cyclin D1, CDK6, or CDK4 levels attenuated MCP1-induced Pak1 phosphorylation/activation and resulted in decreased aortic smooth muscle cells (HASMCs) F-actin stress fiber formation, migration, and proliferation.
23733133 Exogenous mutant cyclin D1 (T286I) accumulated in the nuclei.
23731275 Data suggest that endometrioid endometrial cancer tissue have decreased microRNA-503 levels compared to normal tissue; down-regulation of miR-503 relieves suppression of its target CCND1 which in turn accelerates cell cycle progression.
23720779 Data indicate that XIAP E3 ligase mediates cyclin D1 transcription via PP2A-regulated c-Jun/AP-1 activation.
23696923 KAI1/CD82 and cyclinD1 may serve as markers for determination of invasiveness, metastasis and prognosis of laryngeal squamous cell carcinoma.
23692432 In head and neck squamous cell carcinoma, a significant difference in local control rates was observed between patients with cyclin D1-positive and -negative margins.
23674142 The correlation between CCND1, E2F3 and miR-449b showed that miR-449b could downregulate CCND1 and E2F3 expression. This, in turn, reduced the proliferative ability of colon cancer stem cells.
23672832 Cyclin D1 overexpression is a potential prognostic marker of primary oropharyngeal squamous cell carcinoma.
23670132 CCND1 overexpression impacts the prognosis of ER-positive breast cancer patients, but not patients with unselected primary breast cancer or patients treated with neoadjuvant chemotherapy.
23664541 NRAS or KIT mutations and cyclin D1 amplification can be found in a proportion of primary melanomas of the sinonasal tract.
23661400 the CCND1 G870A polymorphism might not be a potential candidate for predicting esophageal cancer risk (Meta-Analysis)
23661346 Show higher expression of cyclin D1 in parabasal layer of odontogenic keratocyst and the entire cystic epithelium of glandular odontogenic cysts compared to dentigerous cysts and radicular cysts.
23653001 Results of a meta-analysis suggest that the CCND1 G870A polymorphism might be a low-penetrant risk factor for lung cancer, particularly among Asians and smokers.
23648671 overexpression of SOX11 has been demonstrated to be specific for MCL independent of CCND1 positivity, suggesting a diagnostic role of SOX11 expression in t(11;14)-negative MCLs
23625573 Polymorphism in CCND1 gene is associated with breast cancer.
23625206 Data indicate that estrogen induced the expression of c-Jun, Fra-1, c-Fos, cyclin D1 and cyclin E1 while tamoxifen (TMX) decreased the expression.
23613410 Report association of cyclin D genetic polymorphisms with acute lymphoblastic leukemia and breast cancer.
23604117 Treatment with HIV-Tat and morphine activates extracellular signal-regulated kinase-1/2 (ERK1/2), upregulates p53 and p21 levels, and downregulates cyclin D1 and Akt levels in human fetal brain-derived neural precursor cells
23591848 SUMO modification of ATF3 influences CCND1/2 activity and cellular proliferation of prostate cancer PC3 and DU145 cells and explains at least in part how ATF3 functions to regulate cancer development.
23568006 Small interfering RNA silencing of cyclin D1 and BCL-2 expression in osteosarcoma cells enhances the toxicity of doxorubicin.
23568005 Cyclin D1 immunohistochemical expression associates strongly with the approved favourable prognostic factors in primary breast carcinoma.
23567490 CCND1 rs9344 G>A may be a predictive and/or prognostic biomarker in stage II/III colon cancer patients, however, prospective trials are warranted to confirm our findings
23566410 cyclin D1 overexpression correlates strongly with patient survival in oropharyngeal squamous cell carcinoma, but its relationship with human papillomavirus status is very tight
23562784 This over-expressed miR-2909 was found to regulate CCND1 (Cyclin D1) gene expression.
23543735 GCN5 has a role in potentiating growth of non-small cell lung cancer by promoting E2F1, cyclin D1, and cyclin E1 expression
23540573 Functional variants at the 11q13 risk locus for breast cancer lowers cyclin D1 expression through long-range enhancers.
23529990 Propolis extract significantly increased the mRNA level of cyclin D1 in the sigmoid colon mucosa, and the other biomarkers remained unchanged.
23525507 Our results suggest that the post-transcriptional regulation of the CCND1 expression by BHD may be associated with microRNA(s) or RNA binding protein(s) that bind to the 3'UTR.
23515614 Cyclin D1 expression could be used as a biomarker in further validation studies to select cN2 patients that could benefit from induction therapy.
23504185 Although CCND1gene amplification has been observed in central giant cell lesion of the jaws, no difference was observed between the clinical forms of this lesion.
23502783 Single nucleotide polymorphisms in CCND1 gene is associated with multiple myeloma.
23494454 Cyclin D1 expression and CCND1 amplification seem to have a prognostic value for OSCC. Further studies of HNSCC should always consider subanatomic genetic differences
23463347 Expression of CCND1 in cholesteatoma was significantly increased compared to normal external ear canal. In cholesteatoma, a significant positive association was observed between NF-kappaB and CCND1 expression.
23400686 In localized laryngeal cancer, clinicopathological parameters and an interaction of high mTOR and CCND1 mRNA expression were found to be associated with poor patient outcome
23396251 Study assesses the role ofCCND1 genetic variants in fl uencing the genetic susceptibility of non-small cell lung cancer.
23390492 Constitutive CCND1/CDK2 expression contributes to neoplastic mammary epithelial cell transformation.
23388457 The molecular mechanisms underlying cyclin D1 overexpression-induced DNA double-strand breaks during DNA replication in acquired radioresistant cells, is reported.
23383271 miR-9 suppresses the expression of cyclin D1 and Ets1 via the binding sites in their 3'-UTR, thus inhibiting the proliferation, invasion and metastasis of gastric cancer.
23383003 miR-195 plays an important role to inhibit the proliferation of glioma cells, and present a novel mechanism for direct miRNA-mediated suppression of cyclin D1 and cyclin E1 in glioma
23354584 The AG and AA of cyclin D1 genotypes were found to be associated with an increased risk of CRC compared to the GG genotype, with an almost 2-fold increase in OR.
23354566 Cyclin D1 polymorphisms are associayted with prostate-specific antigen recurrence after radical prostatectomy.
23336272 it appears that cyclin D1, CDK4 and p16 function independently in human breast cancer.
23327593 Report cyclin D1 expression in breast papillomas and papillary carcinoma.
23315417 Our findings suggest that p16(INK4A) overexpression is likely secondary to cyclin D1 gene upregulation or amplification in salivary gland tumors
23311506 Results suggest that obesity may contribute to asthma and associated tissue remodeling by modifying the processes related to the CCND1 gene activity.
23301033 Treatment with HIV-Tat and morphine activates extracellular signal-regulated kinase-1/2 (ERK1/2), upregulates p53 and p21 levels, and downregulates cyclin D1 and Akt levels in human fetal brain-derived neural precursor cells
23300886 leptin induces human NP cell cyclin D1 expression and proliferation via activation of JAK/STAT3, PI3K/Akt or MEK/ERK signaling
23292829 The expression of Cyclin D1 was not correlated with any clinicopathological parameters in hepatocellular carcinoma
23270726 our data suggest that the ClC-3 chloride channel is an important target of cyclin D1. Cyclin D1 may regulate the functional activities of the chloride channel via CDK4 and CDK6, and/or the expression of the chloride channel.
23261678 Oleuropein down-regulates NF-kappa B and cyclin D1 but activates p21 in MCF-7.
23255553 This comprehensive characterization of a large series of cyclin D1(-) mantle cell lymphoma patients indicates that these tumors are clinically and biologically similar to the conventional cyclin D1(+) MCL.
23244103 CCND1 G870A polymorphism is associated with breast cancer susceptibility.
23226276 Kaiso represses the cell cycle gene cyclin D1 via sequence-specific and methyl-CpG-dependent mechanism.
23222716 Data indicate that Overexpression or knockdown of miR-145 altered both the mRNA and protein levels of HIF-2alpha and its downstream genes, cyclin D1, matrix metalloproteinase 14 and vascular endothelial growth factor, in neuroblastoma cells.
23201130 the expression of cyclin D1, MCM7, TRIM29, and UBE2C was found to be significantly associated with progression to muscle-invasive bladder cancer.
23163571 this study provided evidence that cyclin D1 overexpression may be a marker of prolonged survival in patient subgroups with aggressive phenotypes.
23161911 dysregulated expression of cyclin D1 in nasopharyngeal epithelial cells may contribute to nasopharyngeal carcinoma pathogenesis by enabling persistent infection of EBV
23144465 miR-31 and miR-130b may have an effect on tumorigenesis of cold and benign thyroid nodules by regulating proliferation and apoptosis and the cell cycle through cyclin D1.
23135283 PAX2 protein induces expression of cyclin D1 through activating AP-1 protein and promotes proliferation of colon cancer cells.
23126531 miR-122 target gene cyclin G1 has regulatory effects on hepatitis C virus replication.
23125009 The CCND1 G/A polymorphism is associated with the early onset of head and neck cancer (HNC) and may contribute to HNC susceptibility in a Pakistani population.
23111452 Our analysis provides evidence that genotypes for the CCND1 A870G polymorphism may be associated with an increased risk of developing oral cancer in the Asian population.
23108396 H2A.Z-dependent crosstalk between enhancer and promoter regulates cyclin D1 expression.
23060014 These findings suggest that CCND1 expression is possibly regulated by estrogens via ERbeta and that this signaling pathway may influence prostate cancer development.
23044415 HPV infection is strongly associated with the pathogenesis of BP, and HPV may be involved in the regulation of the expression of cell cycle related proteins, cyclin D1 and cyclin E, in the pathogenesis of Bowenoid papulosis.
23031786 study to analyze TACSTD2 and Cyclin D1 expression at the mRNA and protein levels and to assess its prognostic significance in invasive ductal breast cancer (IDC); expressions of TACSTD2 and Cyclin D1 in IDC tissues were consistently higher than those in tumor-adjacent non-malignant tissues
23020291 results suggest that CCND1 G870A polymorphism might be a low-penetrant risk factor for esophageal carcinoma, particularly among Asians
23001925 Low CCND1 expression is associated with the progression of cutaneous malignant melanoma.
22982899 When evaluating high-grade uterine sarcomas, cyclin D1 can be included in the immuno-histochemical panel as an indicator of YWHAE-FAM22endometrial stromal sarcoma.
22976805 We suggest that analysis of both GSK3b and cyclin D1 expressions can be considered as a marker of good prognosis in early breast cancer.
22967707 CCND1 G870A gene polymorphism was compared in prolactinoma patients/control and invasive/noninvasive groups. CCND1 G870A gene polymorphism may be an important factor in the early stages of the tumor formation.
22942717 miR-338-3p inhibits proliferation by regulating CyclinD1 and HBx down-regulates miR-338-3p in hepatocelullar carcinoma.
22926658 In patients with stage I-III colorectal cancer, co-existence of CCND1 and VEGF overexpression had significantly poorer disease-free survival rates (P = 0.004) and overall survival rates (P = 0.001).
22922827 findings show transcription of CCND1 is suppressed by miR-15a and miR-16-1 via direct binding to the CCND1 3'-untranslated region (3'-UTR); data demonstrate that CCND1 contributes to osteosarcoma cell proliferation
22905260 RNA inhibition highlights cyclin D1 as a potential therapeutic target for mantle cell lymphoma.
22905217 SUMO modification of Stra13 is required for repression of cyclin D1 expression and cellular growth arrest
22901215 A allele of CCND1 G870A polymorphism confers additional lung cancer.
22893700 Protein kinase N1 is a novel substrate of NFATc1-mediated cyclin D1-CDK6 activity and modulates vascular smooth muscle cell division and migration leading to inward blood vessel wall remodeling.
22884800 this study found that CARMA3 is overexpressed in colon cancers and contributes to malignant cell growth by facilitating cell cycle progression through NF-kappaB mediated upregulation of cyclin D1.
22884659 Cyclin D1 mRNA/protein expression levels were increased in ectopic tissue in peritoneal endometriosis.
22864797 Overexpression of Cyclin D1 is associated with Breast Cancer.
22853846 Required for TLR-9-mediated cyclin D1 expression and subsequently cell proliferation.
22833568 Data show that the MEK-ERK pathway regulates cell cycle-related neuronal apoptosis (CRNA) by elevating the levels of cyclin D1, and the increase in cyclin D1 attenuates the activation of cyclin-dependent kinase 5 (cdk5) by its neuronal activator p35.
22819905 Cyclin D1 expression does not have prognostic role in lymph node negative colorectal cancer.
22814742 Cyclin D1 was down-regulated, while p21 expression was up-regulated by EGCG in dose- and time-dependent manners.
22812184 Cyclin D1 G870A polymorphism is associated with breast cancer.
22801439 Slug regulates cyclin D1 expression by ubiquitin-proteasome pathway in PCa cells
22790016 Early mantle cell lymphoma infiltrates or minimal accumulations of cyclin D1-thornositive B cells occur in tissues from mantle cell lymphoma patients, sometimes antedating lymphoma diagnosis for several years.
22776845 Expression of cyclin D1 in pituitary tumors is related to cell proliferation, recurrence, and metastatic potential.
22770229 Case Report: report a case of peripheral T-cell lymphoma not otherwise specified with heterogeneous nuclear cyclin D1 immunohistochemical overexpression, due to gene copy gain.
22760121 Identified a significant epistasis effect BCL1 by CHRNA4 showing that carriers of the CC genotype at the BCL1 locus who were also homozygous for the T allele at the CHRNA4 locus had the highest depression scores.
22722256 Confirm that cyclin D1 plays an important role in the growth of pancreatic cancer cells and that tumor growth can be inhibited using a tetracycline-inducible cyclin D1 antisense expression system.
22711989 analysis of phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7
22707287 expression of ATM and cyclin B1 may be useful markers to identify patients with poor prognosis who may benefit from close follow-up and aggressive therapy in pancreatic neuroendocrine tumors.
22706868 The recognition of cyclin D1 expression in the proliferation center of a significant minority of chronic lymphocytic leukemia/can be a diagnostic aid and should not lead to the diagnosis of focal mantle cell lymphoma.
22647349 Automated image analysis of cyclin D1 protein expression in invasive lobular breast carcinoma provides independent prognostic information.
22642745 SOX11 is useful in differentiating cyclin D1-positive diffuse large B-cell lymphoma from mantle cell lymphoma
22640743 activation of SIRT1 inhibited the proliferation of pancreatic cancer -PAUF cells by down-regulation of cyclin-D1, a target molecule of beta-catenin.
22629227 Cyclin D1 expression significantly increases with increase in differentiation.
22606291 CCND1 G870A polymorphism was significantly associated with overall colorectal cancer risk. Increased risk was observed only in subgroups of hospital-based studies, PCR-RFLP genotyping methods, sporadic colorectal cancer, and Caucasian ethnicity. Review.
22590809 Cyclin D1 overexpression and CCDN1 amplification, loss of p16 expression and p16 deletion may be among the genetic alterations involved in the pathogenesis of nasopharyngeal carcinoma
22581837 intact EFGR and TIF2 complex was linked with cyclin D1 promoter activity in an LMP1-dependent manner
22565393 Expression of cyclin-D1 in bone marrow in subjects with multiple myeloma is correlated with survival of these patients; up-regulation of cyclin-D1 predicts shorter overall survival.
22553812 In conclusion, cyclin D1 shows heterogeneity in distribution and intensity in benign and malignant thyroid tumors, which disqualifies it as a primary diagnostic marker in these tumors
22534667 The present study suggests that reduced expression of cyclin D2 in stage III NSCLC may be associated with poor RFS. And, cyclin D2 may have a distinct role from cyclin D1 in NSCLC.
22528945 Meta-analyses of available data show a significant association between the CCND1 G870A polymorphism and lung cancer risk, and CCND1 G870A polymorphic variant A contributes to increased risk of lung cancer.
22490843 There is a close relationship between cyclin-D1 expression and ovarian cancer cell activity. A positive correlation is found between lower expression of cyclin-D1 and the concentration of cisplatin.
22484283 The PI3K/Akt, JNK, and ERK pathways were found to mediate MIC-1-induced cyclin D1 expression in HUVECs.
22475046 CCND1 amplification and low nuclear expression of cyclin D1 predicted poor clinical outcome in postmenopausal breast cancer patients treated with either anastrozole or tamoxifen.
22467868 Lin-28 homologue A (LIN28A) promotes cell cycle progression via regulation of cyclin-dependent kinase 2 (CDK2), cyclin D1 (CCND1), and cell division cycle 25 homolog A (CDC25A) expression in cancer.
22467101 Activation of the STAT3/cyclin D1 signaling pathway may be attributed to the malignant transformation of NSCLC.
22460364 Slow progression into S-phase in gamma-tocopherol treated prostate cancer cells is marked by increased TG2 expression and decreased CyclinsE and D1.
22456513 Cyclin D1 homogenous staining regions correlate with poor prognosis in cutaneous melanoma.
22451658 Overexpression of hyaluronan-binding protein 1 (HABP1/p32/gC1qR) in HepG2 cells leads to increased hyaluronan synthesis and cell proliferation by up-regulation of cyclin D1 in AKT-dependent pathway.
22406644 polymorphism at on chromosome 11q13.3 modulates the binding and function of hypoxia-inducible factor at a transcriptional enhancer of CCND1 specific for renal cancers
22406359 CCND1 is amplified and overexpressed in a substantial proportion of vulvar carcinomas and associated with the occurrence of locoregional lymph node metastases, especially in human papillomavirus-negative tumors.
22399638 results showed there were significant differences between nasopharyngeal carcinoma and control groups in the distribution of the genotypic and allelic is an obvious joint effect of CCND1 A870G genotype with smoking habit on nasopharyngeal carcinoma susceptibility
22391566 EpCAM enhances cell cycle progression via the classical cyclin-regulated pathway.
22387541 Rsf-1 is overexpressed in non-small cell lung cancers and contributes to malignant cell growth by cyclin D1 and ERK modulation.
22369110 Geranylgeranoic acid induced rapid downregulation of cyclin D1 in several human hepatoma cell lines, and that this may be a plausible mechanism involved in hepatoma chemoprevention.
22357515 Silica could induce the high expression of cyclin D1 and CDK4 and the low expression of E2F-4, resulting in the cell cycle changes by AP-1/cyclin D1 pathway in human embryonic lung fibroblasts.
22336657 Cyclin D1 overexpression is associated with oral cavity squamous cell carcinoma.
22322158 CCND1 G870A polymorphism is associated with the increased risk of colorectal cancer, especially for sporadic colorectal cancer and in Caucasians
22321253 CCND1 +870A>G polymorphisms and larger tumor size were associated with poor 5-year disease-free survival by the log rank test and multivariate Cox proportional hazards model analysis
22318732 MUC1-C oncoprotein contributes to TCF7L2 activation and thereby promotes cyclin D1 expression in breast cancer cells.
22315488 Overexpression of cyclin D1 is associated with aggressive behavior in mantle cell lymphoma.
22307325 cyclin D1 contributes to chromosomal instability and tumorigenesis by directly regulating a transcriptional program that governs chromosomal stability
22306268 The regulatory role of CD1 on NF-kappaB activity, was investigated.
22304571 CCND1 G870A polymorphism modulated oncogenic cyclin D1b expression in glioma tissues and may be associated with an increased risk of gliomas in Chinese population
22296356 Positive amplification of cyclin D1 was detected in 72% (36) of OSCCs.
22289525 Increased STAT3 and decreased cyclin D1 protein levels may contribute to the recurrence of astrocytic tumours.
22266466 results indicate a role of quinone reductase 2 in the control of AKT/GSK-3beta/cyclin D1 and highlight the involvement of NQO2 in degradation of cyclin D1, as part of mechanism of chemoprevention by resveratrol
22261253 binding of ErbB3(80 KDa) on the promoter activates Cyclin D1 transcription and subsequent protein expression, leading to an increased cell proliferation.
22260073 The high expression level of Stat3 and Cyclin D1 protein in laryngeal squamous cell carcinoma was correlated with the clinical stage, tumor differentiation and lymph node metastases.
22234583 Resveratrol down-regulates the protein cyclin D1 and, in a concentration dependent manner, the phosphorylation levels of protein kinase B and glycogen synthase kinase-3beta in OVCAR-3 ovarian cancer cells.
22231956 Cyclin D1 is molecularly involved in strengthening tumoral proliferation mechanisms in young women and may be seen as a potential blocking molecular switch in corresponding tumors in old women.
22204713 expression of cyclin D1 in papillary thyroid cancer is linked to nodal metastases and that cyclin D1 levels are regulated by Wnt/beta-catenin signaling.
22150974 CCND1 amplification and co-alternation of CCND1(+) /pRb(-) /ppRb(+) may play a crucial role in the prognostic evaluation of patients with esophageal cancer; patients with CCND1(+) /pRb(-) /ppRb(+) have the worst prognosis in all the patients
22135025 Cyclin D1 expression was not correlated with survival in penile cancer.
22133292 The cyclin D1 expression is unlikely to be useful as a prognostic marker for NSCLC in clinical practice from current evidence. The conclusion should be confirmed by a large well-designed prospective study. [Review]
22102309 study demonstrates concordant cyclin D1-related induction profiles of ultraviolet B radiation and arsenite using cDNA microarray analysis.
22100494 Data show that CCND1 expression was an independent baseline predictor of survival in systemic light chain amyloidosis (AL).
22072615 microRNA-365, down-regulated in colon cancer, inhibits cell cycle progression and promotes apoptosis of colon cancer cells by probably targeting Cyclin D1 and Bcl-2.
22065993 The hypothesis that CCND1 expression determines response and clinical outcomes in locally advanced head and neck squamous cell carcinoma (HNSCC) patients treated with neoadjuvant chemotherapy, was tested.
22052559 Gene Expression ratios of CCND1 protein may predict survival and prognosis in patient with oropharyngeal squamous cell carcinomas.
22050898 The aim of the present study was to explore and correlate membrane and nuclear EGFR and cyclin-D1 protein expression with EGFR gene status in colorectal carcinomas
22037875 Data show that cyclin D3 is significantly upregulated in breast cancers and frequently exceeds the expression of Cyclin D1 in ErbB2-positive cases.
22024187 We didn't reveal any important correlations between clinicopathological findings and galectin-3 and cyclin D1 expression and in non small cell lung cancer. We didn't observed also prognostic value of cyclin D1 or galectin-3 expression.
22002566 CCND1 amplification is associated with a more aggressive phenotype within histological grade 2 tumours and luminal A subtype tumours.
21989926 an analysis of the combined expression of EZH2 and cyclin D1 can serve as a more powerful prognostic predictor for patients with HNSCC.
21989330 CCND1 A870G may be useful in predicting clinical outcome in HER2-positive metastatic breast cancer patients treated with lapatinib plus capecitabine.
21972713 The 5-years survival rate was 26% for the group with strong nuclear expression of cyclin D1, and 80% for the group with moderate expression of the marker.
21965784 CCND1 rs9344 polymorphism together with smoking habit maybe a useful biomarker for lung cancer prediction.
21956468 in ovarian carcinomas, findings show that patients with high positivity for p53, p16(INK4a) and Cyclin D1 had a poor prognosis and reduced overall survival
21955753 These results indicate that increased migration of MDA-MB-231 cells following cyclin D1 silencing can be mediated by Id1 and is linked to an increase in EMT markers.
21946890 Findings reveal that an exogenous EGF stimulation may enhance HPV-related cervical cancer cell proliferation by activating EGFR and cyclin D1 that is independent of COX-2 levels.
21912938 Overexpression of cyclin D1 enhanced the proliferation and invasive potential of human glioblastoma cells, while reducing apoptosis.
21892090 significant relationship between nucleostemin and cyclin D1 expression in ovarian neoplasms
21890746 Survival in stage I-II radiotherapy treated head and neck cancer did not depend on ERCC2 A35931C or CCND1 G870A genotype.
21867613 Apoptosis decreased in HL-60 cells with upregulated expression of CCND1 and hTERT.
21850541 reduced expression of the ATM and aberrant cyclin D1 expressions may contribute to the development and/or malignant progression of breast carcinomas
21830375 increased FHIT gene activity can promote apoptosis of cholangiocarcinoma and reduce the expression level of cyclin D1.
21799732 p16( INK4a) is also a modulator of transcription and apoptosis through controlling the expression of two major transcription regulators, AUF1 and E2F1
21789902 CCND1 GG genotype was associated with a lower risk overall in urothelial (P = 0.008, OR = 0.44, 95% CI = 0.24-0.81) and bladder cancer patients (P = 0.008, OR = 0.34, 95% CI = 0.15-0.76) than those of the AA genotype.
21783402 in a cohort of patients with plasmablastic lymphoma of the oral cavity, an increased copy number of the CCND1 gene was seen in 41% of cases with true amplification of CCND1 in 15% of cases
21778791 immunohistochemical expressions of cyclin D1, p16(INK4a) and Ki-67 were analyzed in a total of 127 cases showing multinucleated giant cells
21777578 The expressions of CDK4 and Cyclin D1 increased along with progression of gallbladder mucosa hyperplasia and p16 decreased to the lowest level in gallbladder cancer.
21746927 role of cyclin-D1 in deregulating apoptosis in mantle cell lymphoma cells
21745168 Data show that combination of siRNA-mediated inhibition of the cyclin D1 and cyclin D2 along with chemotherapeutic agents could potentially be used to lower the effective doses of the chemotherapeutic agents and reduce drug-related toxicities.
21738001 Adrenal incidentaloma patients who also carry the polymorphic BCL1 variant exhibit smaller size adrenal nodules.
21654808 findings reveal an unexpected function of a core cell cycle protein in DNA repair, cyclin D1; targeting cyclin D1 may be beneficial also in retinoblastoma-negative cancers which are currently thought to be unaffected by cyclin D1 inhibition
21606015 the CCND1 G870A polymorphism may be an ethnicity-dependent risk factor for digestive tract cancers
21594903 study indicates that CCND1 rs9344 polymorphisms confer host susceptibility to cervical cancer. A allele possesses a relative protective effect probably through the cyclin D1b's inhibition on HPV carcinogenesis
21569306 expression of LPP3 in human colon tumor (SW480) cells potentiated tumor growth via increased beta-catenin stability and CYCLIN-D1 synthesis
21548803 Apigenin increases CASP3 and CASP8 mRNA expression but decreases mTOR and CCND1 mRNA expression in HT29 cells.
21547408 High cyclin D1 is associated with thyroid papillary carcinoma.
21544737 Result suggests that the cyclin D1 870A allele is a low-penetrant risk factor for developing sporadic colorectal cancer, especially among Caucasians.
21537837 CGH array indicated that cases having cyclin D1 with increased copy number were significantly associated with elevated FBXO31 expression levels (P<0.05). FBXO31 could be a novel and robust prognostic marker for ESCC.
21537090 Higher expression of cyclin D1 in oral cancer appears to be closely linked to cell proliferation, differentiation and lymph node invasion.
21526487 The immunoexpression of cyclin D1 was significantly increased in the HPV-positive group compared to the HPV-negative group.
21517236 The cyclin D1 870A allele is a low-penetrant risk factor for development of sporadic colorectal cancer.
21503589 human antigen R knockdown reduces the growth and invasion of breast cancer cells in vitro and affects expression of cyclin D1 and MMP-9
21498736 The C allele of the CCND1 C1722G polymorphism may be a potential predictive and prognostic biomarker for advanced urothelial cancer.
21497295 Copy number changes at 11q13 and 8q34 harboring CCND1 and MYC, respectively, are highly associated with prognosis in melanoma skin cancer.
21492065 TERT expression highly correlated with cyclin D1 expression in laryngeal squamous carcinoma
21487939 over-expression of human OVCA1 in ovarian cancer cells leads to down-regulation of cyclin D1
21455311 Study elucidates a model to regulate glioma cell cycle progression in which hUCBSC acts to control cyclin D1 induction and in concert its partner kinases, Cdk 4 and Cdk 6 by mediating cell cycle arrest at G(0)-G(1) phase.
21454057 c-Kit, p-ERK, and cyclin D1 might help to differentiate thin melanoma from melanocytic nevus
21447152 Data show that the expression of CCND1/CDKN2A correlated with RB1 status in xenograft tumors in vivo.
21438905 The subcellular location of cyclin D1 expression in prostate cancer is linked to specific clinical courses
21410931 Aurora-A overexpressing cells fail to overcome the restriction point at the G1/S transition due to diminished RB phosphorylation caused by reduced Cyclin D1 expression.
21401699 CCND1 amplification is more likely to be associated with breast cancer tumour progression.
21385053 immunohistochemical analysis of MT1 and cyclin D1 in breast cancer specimens from 33 patients
21347341 Epstein-Barr virus nuclear antigen 3C facilitates G1-S transition by stabilizing and enhancing the function of cyclin D1.
21343394 We show here, in an experimental model of cyclin D1 fusion protein transduction in mature B cells, that, cyclin D1 inhibits total mitochondrial activity
21331989 the overexpression of cyclin D1 in rectosigmoid cancers may be more complicated than purely upregulation by beta-catenin
21327470 EMSY amplification does occur independently of CCND1 amplification in a minority of familial breast cancers, supporting its role as a possible breast cancer oncogene
21326383 Elevations in CYCLIN D1 mRNA expression in older persons may indicate that a compensatory expression of this transcript is occurring in an attempt to retain the muscle's proliferative potential.
21315488 Cyclin D1 gene silence by lentivirus-mediated RNA interference can inhibit growth and promote apoptosis of laryngeal squamous cell carcinoma.
21315112 This study is the first to demonstrate that K(+) channels such as hEag1 are directly involved in the IGF-1-induced up-regulation of cyclin D1 and E expression in MCF-7 cells.
21300445 ROC1 expression is negatively correlated with cyclin D1 expression, demonstrating its importance in the degradation of cyclin D1 in melanomas.
21281227 Cyclin D1 positive diffuse large B-cell lymphoma is a post-germinal center-type lymphoma without alterations in the CCND1 gene locus.
21273603 Cyclin D1 single nucleotide polymorphisms are associated with oral cancer.
21268129 There appears to be an influence of CCND1 G870A/G1772C genotypes on genetic susceptibility to esophageal squamous cell carcinoma
21254295 Cyclin D1 overexpression was observed in 47.7% of tumors in the young group and in 32.8% of controls. In the young group, protein overexpression correlated with diminished disease-free survival.
21242960 study identifies miR-378-TOB2-cyclin D1 as a functional module to mediate the cross talk between Myc and Ras signaling in cellular transformation
21212260 Cyclin D1 is a selective modifier of androgen-dependent signaling and androgen receptor function.
21200149 Two alternative splicing variants of cyclin D1 are identified, cyclin D1b and cyclin D1a, which are associated with cellular migration.
21193919 laryngeal cancer is characterized by high proliferative potential mediated by increase in cyclin D1 and H3 mRNAs expression.
21187402 Apoptosis signal-regulating kinase 1 and cyclin D1 compose a positive feedback loop contributing to tumor growth in gastric cancer
21185249 Results suggested that the Cyclin D1 A870G polymorphism is associated with an increased risk of SGTs in the Chinese population. The Cyclin D1 AA genotype not only increased the risk of PA, but also increased the expression of Cyclin D1 in these tumors.
21179427 beta-catenin expressed in nuclei/cytoplasm increases cyclinD1 protein expression, which invokes pterygial cell proliferation.
21161398 The A allele of the CCND1 G870A polymorphism may confer additional breast cancer risk when it comes to homozygosity and Chinese populations.
21159451 Cyclin D-1 protein over-expression is not associated with gene amplification in benign and atypical apocrine lesions of the breast.
21135252 Findings support a role for the AKT-dependent regulation of AIP4/Itch activity in mediating the differential cyclin D1 and c-MYC transcriptional responses to rapamycin.
21131888 Cyclin D1 expression is associated to facial outcome after vestibular schwannoma surgery. The prognostic value of cyclin D1 expression is independent of tumor size and facial nerve stimulation at the end of surgery.
21116504 overexpression of cyclin D1 were found in cells of solid-pseudopapillary tumors.
21107342 Rare variants of CCND1 are risk factors for colorectal cancer, with considerably larger effects than common polymorphisms.
21098327 Case Report: CCND1 and MET genomic amplification during malignant transformation of a giant cell tumor of bone.
21079973 Phosphorylated Stat5 may play an important role in cyclin D1 overexpression and contribute to colonic adenocarcinoma progression.
21062395 RPA1 and RPA2 overexpression seems to be more important during early T-categories of bladder carcinogenesis, showing similar kinetics with cyclin D1
21056029 The present results demonstrate that beta-catenin and p65subunit bind to the cyclin D1 promoter, but only beta-catenin is capable of activating transcription.
21044962 SLUG inhibits the expression of UbcH5c directly through chromatin remodeling and thus, among other downstream effects, elevates the level of cyclin D1
21042715 Cyclin D1 and cyclin D-dependent kinases enhance oral keratinocyte proliferation but do not block keratinocyte differentiation.
21036743 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20971731 Novel function of cyclin D1 illustrates the interplay between tumor proliferation and migration and may explain the attenuation of malignant behavior in breast cancers with high cyclin D1 levels.
20951943 Increased PRMT5 activity mediates key events associated with cyclin D1-dependent neoplastic growth, including CUL4 repression, CDT1 overexpression, and DNA rereplication.
20950152 The results reveal that knock-down of the beta-catenin gene decreases expression and nuclear translocation of beta-catenin protein in colon cancer HT-29 cells and suppresses the expression of the beta-catenin-dependent genes cyclin D1 and c-myc.
20924203 Data show that proliferaton and nuclear expression of cyclin D1 and p-Rb coincide with the early phase of cyst growth, suggesting that there might be a therapeutic window in which cyclin-dependent kinase inhibitors are most effective in ARPKD.
20890425 Cyclin D1 expression was associated with tumor stage and recurrence.
20857402 Homocysteine-induced differential activation of Ras/ERK and PI3K/Akt/p70S6K signaling pathways and consequent expression of cyclins A and D1 are dependent on beta1 integrin.
20856207 show elevated La protein expression in cervical cancer tissue and its correlation with aberrant CCND1 protein levels in cervical tumor tissue lysates
20844743 Observational study of gene-disease association. (HuGE Navigator)
20839920 Treatment with HIV-Tat and morphine activates extracellular signal-regulated kinase-1/2 (ERK1/2), upregulates p53 and p21 levels, and downregulates cyclin D1 and Akt levels in human fetal brain-derived neural precursor cells
20822933 Data indicate that cyclin D1 (CCND1) AA genotype demonstrated increased risk for developing prostate cancer (CaP).
20822933 Observational study of gene-disease association. (HuGE Navigator)
20809334 The protein expression levels of Wnt1, beta-catenin and Cyclin D1 were all positively correlated with the Karnofsky performance scale (KPS) score and World Health Organization (WHO) grades of patients with gliomas.
20801098 cyclin D1 provides a transcriptional switch that allows the tumor suppressor activity of RUNX3 to be repressed in cancer cells.
20737317 COX-2 inhibitor can inhibit the expression of BCL-3 and cyclin D1 in a dose-dependent manner human colon cancer cell line SW480.
20727381 Data demonstrate that mantle cell lymphoma with t(11;14)(q13;q32) has the level of cyclin D1 increased by four orders of magnitude, while other B-cell lymphomas without t(11;14)(q13;q32) have the level of cyclin D1 significantly elevated above normal.
20723296 Celastrol inhibits the proliferation and induced the apoptosis of HL-60 cells which may be related with down-regulation of p-Act and cyclin D1 expressions.
20714998 The data suggest that URG4 may play an important role in the development of hepatocellular carcinoma by partially regulating the expression of cyclin D1.
20701069 p53 Expression was statistically more common with less cyclin D1 expression in Chinese as compared with Australian women.
20699365 In KRAS mutant tumors, PIK3CA mutation restores cyclin D1 expression and G(1)-S cell cycle progression so that they are no longer dependent on KRAS and MEK/ERK signaling.
20683643 In HeLa cells, mir-200b directly reduced the expression of RND3 at the mRNA and protein levels, which thereby promoted expression of the downstream protein cyclin D1 and increased S-phase entry
20683061 CDKN1B polymorphism appears to be a predictive factor for breast cancer and CCND1 polymorphism may be a prognostic biomarker. Larger study groups are needed to fully elucidate the role of CCND1 and CDKN1B polymorphisms in the development and prognosis.
20683061 Observational study of gene-disease association. (HuGE Navigator)
20683026 Findings suggest that genetic variants of A870G might be associated with distant metastasis and also gender in colorectal cancer.
20683026 Observational study of gene-disease association. (HuGE Navigator)
20680693 cyclin-D1 overexpression is associated with leiomyosarcoma.
20680537 the CCND1 870A gene variant may be a genetic risk factor in the incidence of advanced cervical cancer
20680537 Observational study of gene-disease association. (HuGE Navigator)
20662834 Observational study of gene-disease association. (HuGE Navigator)
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20631638 High cyclin D1 is associated with squamous cell carcinoma in non-small cell lung cancer.
20631637 Overexpressions of nuclear cyclin D1 is associated with non-small cell lung cancer.
20631636 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628002 Expression of constitutively active mTOR conferred resistance to cryptotanshinone inhibition of cyclin D1 expression and Rb phosphorylation, as well as cell growth.
20618968 clodronate has little influence on osteoblast proliferation and extracellular matrix production in terms of cyclin D1 gene expression
20616110 The gene expressions of cyclins D1 in Cushing's disease were significantly suppressed than those in non-functioning adenomas.
20586028 SCCA, EGFR and cyclin D1 may prove to be useful tumor markers in oral squamous cell carcinoma.
20581865 Abolishing the expression of cyclin D1, Cdk4 or Nek2 in MCF10A human mammary epithelial cells expressing H-Ras(G12V) abrogated Ras-induced centrosome amplification.
20578819 Overexpression of CCND1 is associated with good response to bortezomib therapy in multiple myeloma.
20577923 Perioperative total parenteral nutrition has no significant impact on the expression of cyclin D1, recurrence or metastasis of colorectal cancer.
20575692 Increased risk of urinary bladder cancer was associated with the combined variant CCND1 genotypes among men 65 years of age and smokers. The G870A polymorphism was significantly associated with risk of developing superficial urinary bladder cancer.
20575692 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
20564361 Expression of Slug decreases cyclin D1 expression in human prostate cancer cells.
20543468 Treatment of HepG2 cells with HMBG1 increases expression of cyclin D1 and PCNA.
20540739 Positive correlation between high heterogeneity, centrosome abnormalities and CCND1 amplification was found in T1G3 bladder carcinomas.
20515940 Rac1 knockdown by RNAi interference confirmed the specificity of NSC23766 and requirement for Rac1 in the regulation of cyclin D1, survivin, and XIAP in breast cancer cells.
20512928 Hr and VDR interact via multiple protein-protein interfaces, catalyzing histone demethylation to effect chromatin remodeling and repress the transcription of VDR target genes that control the hair cycle.
20503270 in HPV positive oropharyngeal cancer, cyclin D1 has a role in locoregional recurrence, event and death and pRb has a role in event and death
20485284 BRAF V600E mutations are associated with MSI-H status and cyclin D1 overexpression and characterize a subgroup of patients with poor prognosis.
20473525 The G870A polymorphism in CCND1 may not contribute to the etiology of cervical cancer in Chinese populations.
20473525 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20466633 Data show that that cyclin D1 gene was amplified in 45.4% of ESCC patients.
20460515 Alternative splicing of the CCND1 transcript is associated with prostate cancer progression.
20459741 cyclin D1b participates into multiple myeloma pathogenesis via previously unrevealed actions.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20443083 our meta-analysis strongly suggested that the CCND1 G870A polymorphism is not associated with head and neck cancer risk
20443083 Meta-analysis of gene-disease association. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20429623 CCND1 amplification was associated with breast cancer.
20426528 Protein kinase C alpha promotes the proliferation of human airway smooth muscle cells sensitized with atopic asthmatic serum via up-regulation of cyclin D1 expression.
20418097 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20407865 Increased expressions of PKCalpha and cyclin D1 might be involved in the pathogenesis of abnormal proliferation of pulmonary artery smooth muscle cells in smokers with normal lung function and smokers with mild to moderate COPD.
20404095 Cyclin D1's participation in a feed-forward loop could contribute to increased breast cancer risks associated with estrogen and progesterone combinations.
20401451 Cyclin D1 might be involved in the process of human pulmonary artery smooth muscle cell proliferation and migration stimulated by cigarette smoke extract.
20397048 Genetic polymorphism of CCND1 is associated with CpG island hypermethylation status in gastric cancer, especially in the advanced stage, but is independent of clinico-pathological features.
20397048 Observational study of gene-disease association. (HuGE Navigator)
20392877 These data link the SMRT corepressor directly with SRC family coactivators in positive regulation of ERalpha-dependent gene expression.
20389301 Prediction of CCND1 amplification using plasma DNA is thought to be a promising prognostic biomarker in esophageal squamous cell carcinoma patients.
20380574 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20373052 up regulation of EGFR, cyclin D1 and h TERT proteins correlates with advanced stage in squamous cell carcinoma of the larynx
20372799 Hemin inhibits cyclin D1 and IGF-1 expression via STAT5b under hypoxia in ERalpha-negative MDA-MB 231 breast cancer cells
20359118 Stat3 and Cyclin D1 were overexpressed in laryngeal neoplasm tissue, and they have a positive relationship.
20359085 There was significant direct correlation between the expression of Pin1 and Cyclin D1 in laryngeal papilloma.
20347627 CCND1 G870A single nucleotide polymorphism is associated with an increased risk of hepatocellular carcinoma in our Turkish population
20347627 Observational study of gene-disease association. (HuGE Navigator)
20338923 These results suggest that increased cyclin D1 expression, which occurs in liver regeneration and liver diseases, may contribute to the feminization seen in these settings.
20306448 data do not show an association between CCND1 A870G SNP and Crohn's disease-associated or ulcerative colitis-associated colorectal neoplasia
20306448 Observational study of gene-disease association. (HuGE Navigator)
20304954 miR-193b represses cell proliferation and regulates CCND1 expression
20232305 High glucose stimulated mesenchymal stem cell proliferation through cyclin D1/E and TGF-beta(1) expression via Ca(2+)/PKC/MAPKs as well as PI3K/Akt/mTOR signal pathways.
20231315 Rem2 mediates the fibroblastic growth factor 2 (FGF2) signaling pathway to maintain proliferation of hESCsby suppressing the transcriptional activity of p53 and cyclin D(1)
20204402 Observational study of gene-disease association. (HuGE Navigator)
20204303 The water extract of the lettuce Lactuca sativa activated checkpoint kinase 2, induced the tumour suppressor p21, and downregulated the proto-oncogene cyclin D1 in HL-60 leukaemia cells and MCF-7 breast cancer cells
20181625 There is no statistically significant association between the expression of cyclin D1 and overall survival or relapse of patients with laryngeal cancer.
20179208 Breast cancer cell motility is affected by disturbing cyclin D1 levels or cyclin D1-cdk4/6 kinase activity.
20172376 cyclin D1 expression was significantly correlated with lymphatic metastasis and neoplasm invasiveness in papillary thyroid carcinoma.
20160059 ZIP4 overexpression causes increased IL-6 transcription through CREB, which in turn activates STAT3 and leads to increased cyclin D1 expression
20154722 GATA3 as a gene involved in transcriptional regulation of Cyclin D1.
20137349 Ep-CAM or cyclin D1 expression is a unfavorable prognostic factor in gallbladder carcinoma.
20113529 CCND3 is the primary driver of the cell cycle, in cooperation with CCND1 that integrates extracellular mitogenic signaling.
20103831 Increased protein expression of p16 and cyclin D1 in squamous cell carcinoma tissues.
20101207 Tax binds the cyclin D1 promoter-proximal cyclic AMP response element (CRE) in the presence of phosphorylated CREB (pCREB) in vitro, and together the Tax-pCREB complex recruits the cellular co-activator p300 to the promoter.
20087644 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20072652 Data show that LLL12 inhibited STAT3 phosphorylation, induced apoptosis as indicated by the increases of cleaved caspase-3 and poly (ADP-ribose) polymerase, and also downregulated cyclin D1, Bcl-2, and survivin at both protein and messenger RNA levels.
20067552 data show that alphaB-crystallin is highly expressed in melanocytes contributing, in part, to cyclin D1 turnover
20062011 cyclin D1 can be included within an immunohistochemical panel to aid in the distinction between reactive cervical glandular lesions and adenocarcinoma in situ.
20028857 Our results identify Sam68 as the first splicing factor to affect CCND1 alternative splicing in prostate cancer cells
19967453 Fluorescence in situ hybridization was more sensitive than Southern blot at demonstrating low levels of gene amplification and, additionally, permitted assessment of the distribution of cyclin D1 gene among chromosomes.
19956831 the cyclin D1b represses breast cancer cell growth by antagonizing the action of cyclin D1a on ERalpha-mediated transcription
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19941161 There was no significant association between breast cancer risk and the combined genetic polymorphisms of CCND1 and ESR1 in Korean women.
19941161 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19935879 Data suggest that wogonin induced G1 phase arrest in HeLa cells by modulating several key G1 regulatory proteins, such as Cdk4 and cyclin D1, as well as up-regulation of a p53-mediated p21Cip1 expression.
19933579 Cyclin D1 is a bona fide target gene of NFATc1 and is sufficient in the mediation of injury-induced vascular wall remodeling
19923826 The etiology of gastric cancer is involved in multiple genetic and epigenetic alterations, by molecular biological study, including oncogenes cell-cycle regulators (such as cyclin D1)
19921577 Expression of cyclin D1 and P21WAF1 is related to drug-resistance of gastric cancers.
19919588 59% of Paget's disease of the vulva cases examined overexpressed cyclin D1 compared with 8% of Paget's disease of the breast cases.
19917254 Findings suggest that targeting USP2 is an effective approach to induce growth suppression in the cancer cells addicted to cyclin D1 expression.
19915977 We show that JAG1 down-regulation reduces direct binding of Notch to the cyclin D1 promoter
19915615 Cyclin D1 expression was increased by enhanced mRNA cap methylation.
19904758 High CCND1 amplification is associated with estrogen receptor positive breast cancer.
19903334 Exposure of human cancer cell lines to caffeine and CGK733 was associated with a rapid decline in cyclin D1 protein levels
19900369 beta-catenin and Cyclin D1 increased in gliomas may be precipitate the tumorigenesis of glioma.
19898427 among endometrial stromal tumors and related sarcomas, undifferentiated endometrial sarcomas featuring uniform nuclei were characterized by frequent coincident expression of beta-catenin and cyclin D1.
19885547 aberrant regulation of S100P in HCC might activate cyclin D1 and CDK expression and contribute to the mitogenic potential of tumor cells during Hepatocellular carcinoma carcinogenesis.
19883431 we determined the significance of loss or downregulation of CD79a, overexpression of cyclinD1, and c-maf expression in bone marrow specimens with plasma cell myeloma
19850937 Zinc protoporphyrin regulates cyclin D1 expression independent of heme oxygenase inhibition.
19826048 Observational study of gene-disease association. (HuGE Navigator)
19823825 Data suggest that the amplification of the cyclin D1 gene can predict the more aggressive natural course of proliferating haemangiomas and the limited outcome and higher incidence of complications after non-excision treatment modalities.
19823025 these data highlight the regulatory role of the cyclin D1 3'UTR in the expression and phenotype of cyclin D1
19822419 The cyclinD1 and IL-1RN polymorphisms were associated with survival in neoadjuvant-treated gastric cancer.
19822419 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19821490 Study identified an overrepresentation of focal amplifications of known (FGFR3, CCND1, MYC, MDM2) and novel candidate genes (MYBL2, YWHAB and SDC4) in stage Ta bladder carcinoma.
19806481 Compared with the normal cerebellum, expression of cyclin D1 in medulloblastoma was significantly higher. Upregulation correlated with metastases, pathological type, necrosis, & differentiation level & direction.
19802676 Chondrocytes in cartilage biopsies of ACH children were characterized by the presence of growth arrest mediated by STAT(signal transduction and transcription) activation and increased expression of p21(p21CIP1) and cyclin D1
19801969 sox11 may be involved in the upregulation of cyclin D1 in hairy cell leukemia
19801633 Data show that B[a]PDE increases cyclin D1 expression, and activate the PI3-kinase/Akt/MAPK- and p70s6k pathway in Beas-2B bronchial epithelial cells.
19800042 Data show that P53 can inhibit cyclin D1 promoter activity via an NF-kappaB site-dependent manner and its binding activity increased after heat shock.
19795398 Fndings suggest that the selected polymorphisms of p21, CCND1, and caspase8 may not contribute to the risk of colorectal cancer.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19787783 Amplification of both PPFIA1 and CCND1 were significantly associated with high-grade breast cancer phenotype but were unrelated to tumor stage or nodal stage
19780858 there was no significant difference in cyclin D1 expression between BRCA2 and BRCAX cancers
19779113 The risk of breast cancer development and prognosis may be associated with genetic variation in the CCND1 genotype, which may be used as a biomarker for further studies.
19779113 Observational study of gene-disease association. (HuGE Navigator)
19774638 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19760977 It appears that the G870 polymorphism of CCND1 is not associated with the risk of GC in the Japanese population.
19760977 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19757306 Studies indicate that mTOR inhibition treatment strategy was owing to the characteristic overexpression of cyclin D1 regulated by mTOR signaling.
19750108 Observational study of gene-disease association. (HuGE Navigator)
19738611 Observational study of gene-disease association. (HuGE Navigator)
19728335 IKKalpha, IKKbeta, RANK, Maspin, c-FLIP, Cip2 and cyclinD1 were found to show significant differences between hepatocellular tumor tissue and its corresponding adjacent tissue.
19724860 Overexpression of Notch1 in laryngeal carcinoma cell line was coupled with the downregulation of cyclin D1
19723065 Data show that the inhibition of cell proliferation with L.lac CF was associated with an increase in p53 and p21 expression, the reduction of cyclin D1 expression, and retinoblastoma protein phosphorylation.
19706803 cyclin D1b is specifically elevated in prostate tumorigenesis
19706803 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690970 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19687314 immunostaining of p16, cyclin D1, Ki-67, p53, and ProEx C was evaluated in 144 cervical tissue specimens encompassing normal or benign epithelial lesions, low- and high-grade squamous intraepithelial lesions and cervical carcinoma
19679881 Data show that the knockdown of cyclin D1 is compensated by the upregulation of cyclin D2, a more powerful strategy would be to inhibit both cyclin D1 and cyclin D2.
19670700 Immunoreactivity index of p21 and cyclin D1 is independent of the morphological pattern of human endometrium, patients' age and gynaecological history of patients.
19666944 Cyclin D1 and pRb showed a progressive increase in expression from benign to malignant tumors but with relative decreases in the more advanced tumors (thick primaries and metastatic melanomas).
19666237 Results confirm the importance of alterations in CCND1 and CTTN with respect to areca-associated oral squamous cell carcinoma, and demonstrates that there is an early occurrence of amplification of these genes in the risk population.
19638577 Loss of cyclin D1 in ovarian cancer cells treated with SHetA2 is sufficient to induce G(1) cell cycle arrest and this strategy is not impeded by the presence of cyclin E2.
19636701 co-amplification of CCND1 and EMSY identified a poor prognostic subset of ER-positive tamoxifen-treated patients
19634112 XRCC1, CCND1 and GSTM1 polymorphisms have roles in oral leukoplakia after exposure to tobacco
19634112 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19633425 Data show that sorafenib inhibited the raf/ MEK/ERK signal pathway, and downregulated cyclin D1 and Rb levels.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19602458 An immunohistochemical and molecular study of the BCL2, MKI67, and CCND1 genes in Synovial sarcoma (SS) was performed. The high level of BCL2 mRNA correlated with a high level of CCND1 mRNA, but not with MKI67 mRNA level.
19589865 The MAPK kinase-1/2 inhibitor, U0126, fully restored cAMP down-regulation of CCND1 in endometrial stromal fibroblasts of women with vs. without endometriosis.
19585495 Cyclin D1 polymorphisms are associated with cervical cancer.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19575018 Cyclin D1 interacts with both FOXO1 and FOXO3a and inhibits their transcriptional activity and anoikis-promoting function.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19572978 over-expression of DIXDC1 might target p21 and cyclin D1 to promote colon cancer cell proliferation and tumorigenesis at least partially through activation of the PI3K/Akt pathway.
19564413 Data indicate that cyclin E2-Cdk2 activation by estrogen occurs via E2F- and CHD8-mediated transcription of cyclin E2 downstream of cyclin D1, and does not require c-myc.
19558863 The CCND1 870A allele is associated with nasopharyngeal carcinoma in Han population.
19558863 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19554511 Cyclin D1 mRNA expression does not result in the production of functional CD1 protein in anaplastic large cell lymphoma.
19550124 Data show that DADS induces G(2)/M arrest in colon cancer SW480 cells, probably through the downregulation of PCNA, p53 and cyclin B1 and upregulation of p21(WAF1).
19549773 Cyclin D1 overexpression is associated with longer survival in colon cancer.
19538740 microRNAs that can silence cyclin D1 (CCND1) include miR-503, miR-19a and miR-155, but only miR-503 suppresses the protein expression
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19525979 Observational study of gene-disease association. (HuGE Navigator)
19505905 overexpressed cyclin B1, veiling the effect of cyclin D1 or cyclin E, mediated nickel-caused M-phase blockage and cell growth inhibition, which may render pulmonary cells more sensitive to DNA damage and facilitates cancer initiation
19502783 DACH1 inhibits breast cancer cellular proliferation via cyclin D1.
19499154 propose that NGX6 expression is lost in the process of human colorectal carcinogenesis. Its overexpression can inhibit expression of transcription factors AP-1 and Ets-1, and down-regulate transcriptional activity of the cyclin D1 promoter in human CRC
19489683 CCND1 G870A polymorphism could act as a risk factor for the development of cervical cancer.
19489683 Observational study of gene-disease association. (HuGE Navigator)
19477949 cyclin D1 has a role in resistance to antiestrogen arzoxifene
19474518 found overexpression of cyclin D1 in 4 of 11 cases of extramedullary plasmacytoma, associated with poor prognosis
19470724 Cyclins B1, D1, and E1 have distinct expressions in different breast cancer subtypes.
19467018 analysis of Cyclin D1 expression in typical chronic lymphocytic leukemia [case report]
19453261 Observational study of gene-disease association. (HuGE Navigator)
19448414 APC, E-cadherin, beta-catenin and cyclin D1 may play important roles in tumorigenesis of esophageal squamous cell carcinoma(ESCC).
19443866 PGP 9.5 and cyclin D1 coexpression was closely associated with tumor aggressiveness and can be classified as a marker for predicting the outcome of resection-treated skin cancer patients.
19440933 Quercetin inhibits human SW480 colon cancer growth in association with inhibition of cyclin D1 and survivin expression through Wnt/beta-catenin signaling pathway.
19430707 Results show that overexpression of CDK4, cyclin D1, and Rb proteins, and loss of expression of proteins p16, p27, and p19 were statistically significant in NPC tissues compared with non-cancerous NPE (P<0.05) by real-time RT-PCR and tissue microarray.
19415719 Cyclin D1b variant promotes cell invasiveness independent of binding to CDK4 in bladder cancer cells.
19412162 ectopic expression of FBXO31 acts through a proteasome-directed pathway to mediate the degradation of cyclin D1, an important regulator of progression from G1 to S phase, resulting in arrest in G1
19386349 CCND1 rearrangement and cyclin D1 overexpression in renal oncocytomas: frequency, clinicopathologic features, and utility in differentiation from chromophobe renal cell carcinoma are reported.
19379556 In AML cyclin D1 mRNA was overexpressed, and its expression level was significantly higher than that in benign blood disease group, but there was no statistical difference among the subtypes of AML.
19375306 Meta-analysis of gene-disease association. (HuGE Navigator)
19373442 Cyclin D1 A870G polymorphism in Brazilian colorectal cancer patients.
19373442 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19336552 Observational study of gene-disease association. (HuGE Navigator)
19330026 Data show that FGFR1 and DDHD2 at 8p12 cooperated functionally with MYC, whereas CCND1 and ZNF703 cooperated with a dominant negative form of TP53.
19324500 cyclin D1 expression might play a role in giant cell formation instead of promoting cell proliferation during Giant cell tumor of bone tumorigenesis
19321861 APRIL-mediated signaling in follicular lymphoma B-cell growth results in phosphorylation of Rb and up-regulation of cyclin D1
19303206 the overexpression of cyclin D1 found in colon cancer favours tumour dedifferentiation as one mechanism of tumour progression.
19302219 Observational study of gene-disease association. (HuGE Navigator)
19289374 non-small-cell lung cancer patients with eIF4E(+)/cyclin D1(-) have poorer outcome, those with eIF4E(-)/cyclin D1(+) have a more favorable outcome, and those with eIF4E(+)/cyclin D1(+) have an intermediate outcome (P = .02)
19287456 specific cyclin D1 isoforms are associated with discrete forms of breast cancer and high cyclin D1b protein levels hold prognostic potential.
19287456 Observational study of gene-disease association. (HuGE Navigator)
19258477 Strengthened signals in imputation-based analysis at CCND1 SNPs rs602652, rs3212879, rs649392 and rs3212891 lend evidence to the role of cell cycle genes in ovarian cancer etiology.
19258477 Observational study of gene-disease association. (HuGE Navigator)
19242061 Amplifications and deletions of G1/S-phase transition genes, CCND1 and MYC is associated with early breast cancers.
19237565 crystal structure of CDK4 in complex with cyclin D1 at a resolution of 2.3 A
19203829 Overproduction of cyclin D1 is dependent on activated mTORC1 signal in nasopharyngeal carcinoma: implication for therapy.
19187116 A meaningful correlation was not found between grades of cyclinD1 expression and basal cell carcinomas
19183483 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19166930 Adrenomedullin promotes cell transit beyond cell cycle phases with a concomittant increase in cyclin D1 protein level. Adrenomedullin effects cell proliferation through up-regulation of cyclin D1.
19152247 positive expression of retinoblastoma protein and cyclinD1 might be an early event in gastric carcinoma
19147768 Poly E inhibits growth of transformed aerodigestive epithelial cells by suppressing cyclin D1 expression through both transcriptional and posttranslational mechanisms
19143767 either p57Kip2 "apice" or p27Kip1 "apice" inhibitors bound to cyclin D1/cdk4 complex, thus, suggesting that they cooperated to inhibit the activity of cyclin D1/cdk4.
19142864 Decreased expression of CCND1 is associated with Increased expression of HER2 in breast tumors.
19142864 Observational study of gene-disease association. (HuGE Navigator)
19139013 These findings support CD1 genotype and protein expression as important risk markers for laryngeal cancer
19139013 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19136653 Cdk-6 overexpression, alone or in combination with cyclin D1, strikingly stimulates human beta-cell replication, both in vitro as well as in vivo, without inducing cell death or loss of function.
19134409 The PKCalpha-ERK1/2 cascade is involved in PMA induced up-regulation of cyclin D1 and P21(cip1) and proliferation in human airway smooth muscle cells.
19129688 JAK2V617F-positive essential thrombocythemia and multiple myeloma with IGH/CCND1 gene translocation coexist, but originate from separate clones
19124506 Out of 710 SNPs in 120 candidate genes, the most significant association was CCND1 SNP rs3212879 in estrogen receptor-negative breast cancer.
19124506 Observational study of gene-disease association. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19106744 Homeobox gene CDX2 inhibits human pancreatic cancer cell proliferation by down-regulating cyclin D1 transcriptional activity.
19106611 Levels of cyclin D1 mRNA were specifically reduced and binding of RNA Polymerase II to the CYCD1 promoter was decreased in Mcm7-depleted cells.
19096232 These results showed that the expression of cyclin D1, p21 and p27, alone or in combination, are early events in gastric tumorigenesis and may serve as a candidate molecular marker for the early gastric carcinoma.
19091404 Notch-1 may be mediated through regulating the expression of cell cycle regulatory proteins cyclin D1, CDK2 and p21 and the activity of Akt signaling
19086036 The switch from Mnt-Max to Myc-Max during bile duct ligation (cholestasis) and in hepatocytes treated with lithocholic acid is responsible for the induction in p53 and cyclin D1 expression and contributes to apoptosis.
19084934 Over-expression of the Tp53, CCND1, and C-myc genes appears to play a role in development of human cancer by regulating the expression of mRNA.
19080374 ERKs and JNKs, but not p38, are responsible for the decrease of cyclin D1 and CDK4 protein expression level in human embryonic lung fibroblasts induced by quartz.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19074853 UBE1L-ISG15 preferentially inhibits cyclin D1 in lung cancer
19071090 These data indicate that communication between ATM and cyclin D1 may be required for maintenance of genomic integrity achieved by rapid arrest of the cell-cycle, and that disruption of this crosstalk may increase susceptibility to cancer.
19070887 The findings suggest that a thalidomide-based regimen may overcome the poor prognosis associated with a cyclin D1-negative or fibroblast growth factor receptor 3-positive phenotype.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19055446 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19047108 the G/A870 polymorphism in the CCND1 locuw does not correlate with patient; however, total D1 expression seems to be associated with esophageal adenocarcinoma patient survival. survival
19047108 Observational study of gene-disease association. (HuGE Navigator)
19040567 Proliferation parameters of differentiating cells correlate with the activity and structure of cyclin A/E-CDK2 but not of cyclin D-CDK4/6-p27 complexes.
19034659 expression unchanged in Crohn's disease, ulcerative colitis, and amoebic colitis
19020753 Ectopic cyclin D1 overexpression increases chemosensitivity but not cell proliferation in multiple myeloma.
19009649 c-Fos overexpression increases the proliferation of human hepatocytes by stabilizing nuclear Cyclin D1.
18991334 CCND1 amplification showed no relationship with tumour relapse.
18988190 These results support the hypothesis that STAT3 and CREB play an important role in leptin signaling pathway that leads to the proliferation of Ishikawa cells, thus establishing a direct association between obesity and endometrial tumorogenesis.
18983468 Cyclin D1 activation is associated with Microsatellite instability and inversely with p21 loss in colorectal cancers.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18949380 TsA markedly down-regulated the expression of cyclin D1 and CDK4, up-regulated the expression of p21WAF1 and p53 and induced cell cycle arrest at the G1 phase in MCF10A-ras cells
18942709 cyclin D1 has a role in cisplatin chemosensitivity in oral squamous cell carcinoma
18942117 results show that human cyclin D1b has different biological functions than cyclin D1a and confirm its oncogenic properties
18936968 CK7, bax, CCND1, and HER2 represent marker proteins and frequently amplified genes in carcinomas of the ampulla of Vater.
18925698 univariate analysis showed overexpression of cyclin D1 & underexpression of p27 predicted lymph node metastases in papillary thyroid carcinomas; low risk group was cyclin D1 negative & p27 positive; high risk group was cyclin D1 positive & p27 negative
18844221 NDRG2 modulates intracellular signals to control cell cycle through the regulation of cyclin D1 expression via phosphorylation pathway and down-regulation of AP-1
18843022 Meta-analysis of gene-disease association. (HuGE Navigator)
18842998 Polymorphisms and expression of CCND1 might modify the level of DNA damage in vinyl chloride exposed workers.
18842998 Observational study of gene-disease association. (HuGE Navigator)
18839518 Cyclin D1 and CDK4 were active genes and could positively regulate the cell cycle alterations induced by benzo(a)pyrene.
18829570 The chimeric mRNA is a bicistronic transcript of post transcriptional origin that independently translates the Cyclin D1 and Trop-2 proteins in cancer cells.
18823025 GG genotype of CCND1 is associated with oral premalignant lesions.
18823025 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18822177 results suggest that the cyclin D1 870 G>A polymorphism is possibly involved in the development of endometrial cancer
18822177 Observational study of gene-disease association. (HuGE Navigator)
18819000 CCND1 G870A polymorphism is associated with breast cancer.
18819000 Meta-analysis of gene-disease association. (HuGE Navigator)
18799029 Wild type RASSF1A expression could induce G1 phase arrest in QGY-7703 cells, which is accompanied by a down-regulation of Cyclin D1 protein expression through a post-transcriptional mechanism.
18798551 We detected a cyclin D1 overexpression exclusively in bone marrows infiltrated with Mantle Cell Lymphoma (MCL), including minimal residual infiltration.
18794151 Study shows a novel mechanism regulating Cyclin D1 expression and offers new insight into the role of SNIP1 and associated proteins as regulators of proliferation and cancer.
18794045 The p16INK4a/cyclin D1/pRB pathway was altered in gastrointestinal tract endocrine tumors.
18787961 Overexpression of Cyclin D1 is associated with lymph node metastases in laryngeal squamous cell carcinoma.
18769147 Inhibition of PI3-K/Akt induces a 40% decrease of cyclin D1 half-life as a result of accumulation of the dephosphorylated/active form of GSK-3beta within the nucleus, where it can phosphorylate cyclin D1 on Thr286 thereby promoting its nuclear export.
18758380 Activated STAT3 may take effect on promoting transcription of its downstream target gene CyclinD1.
18753363 Cyclin D1 and UBCH10 amplicons in anaplastic thyroid carcinoma.
18715870 two mechanistically distinct phases of Rac-dependent cyclin D1 expression and emphasize that the acquisition of Rac/ERK co-dependence is required for the mid-G1 phase induction of cyclin D1 associated with S phase entry.
18715616 Expression of cyclin D1 splice variants is differentially associated with outcome in non-small cell lung cancer patients.
18713830 Results show that VRK1 activates CREB and regulates cell cycle progression in the DNA replication period by inducing cyclin D1 (CCND1) expression.
18710949 The present data support a role for p27 in the assembly of D-type cyclin-Cdk complexes and indicate that both cyclin D1-Cdk4-p27 assembly and kinase activation are regulated by p27 phosphorylation.
18710938 The transcriptional activation of miR-302 and the translational repression of its targets, such as cyclin D1, may provide a link between Oct4/Sox2 and cell cycle regulation in pluripotent cells.
18703151 These results demonstrate that ERKs and JNKs are responsible for the decrease of cyclin D1 and CDK4 expression levels in human embryonic lung fibroblasts induced by silica.
18695676 cytosolic cyclin D1 is able to regulate apoptosis by interaction with Bax in LDIR-induced adaptive resistance.
18695042 These studies identify a novel cyclin D1/miR-17/20 regulatory feedback loop through which cyclin D1 induces miR-17-5p/miR-20a.
18677114 Alterations of transcriptional regulators in disease may lead to splicing alterations.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18665077 FGFR1-IIIb and FGFR1-IIIc are coexpressed, and the FGFR1-III isoforms are differentially regulated by growth factors and cyclin D1.
18665038 Overexpression may reflect early genetic events during the progression of Barrett esophagus-associated carcinogenesis.
18650423 beta-TrCP-dependent degradation takes part in controlling cyclin D1 turnover when cancer cells undergo glucose starvation, which endows physiological relevance to this novel mechanism.
18644870 Results describe the effects of estradiol on cyclin D1, PS2, and c-fos gene expression by measuring levels of RNA polymerase II on DNA templates, levels of nascent transcripts associated with RNA polymerase II, and levels of RNAs.
18640142 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18632615 cyclin D1b protein is aberrantly regulated and could contribute to therapeutic failure in the context of ER-positive breast cancer
18625744 cyclin D1 gene targeted cell lines lost the translocated chromosome (t(11;14)) and the nonrearranged cyclin D1 locus reverted from CpG hypomethylated to hypermethylated
18618300 Overexpression of cyclin D1 is associated with cholangiocarcinoma.
18616527 we here propose that reactive oxygen species-mediated cyclin D1 degradation contributes to tumor growth retardation in hypoxic environments
18609126 CCND1870 GG genotype is associated with an increased risk for non-cardiac gastric cancer in patients in a high-risk area of China.
18609126 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18604165 cell cycle exit is preceded by p27-dependent inhibition of cyclin A-Cdk1/2, cyclin D1 downregulation and reduced pre-mitotic pRb pocket protein phosphorylation
18598945 Mutations in Fbx4 inhibit dimerization of the SCF(Fbx4) ligase and contribute to cyclin D1 overexpression in human cancer.
18562319 hnRNP A1 has a role in mediating rapamycin-induced alterations of cyclin D1 and c-myc IRES activity in an Akt-dependent manner and provide the first direct link between Akt and the regulation of IRES activity
18548202 These findings suggest that CCND1 (G870A) polymorphism may be associated with increased risk of squamous cell carcinoma of the uterine cervix in north Indian women.
18548202 Observational study of gene-disease association. (HuGE Navigator)
18547262 Observational study of gene-disease association. (HuGE Navigator)
18514338 A significant elevation in expression of CCND1 in oral squamous cell carcinoma cells was seen in carbon and neon-irradiated cells.
18507837 Observational study of gene-disease association. (HuGE Navigator)
18491248 Estrogen and progesterone lower cyclin B1 AND D1 expression, block cell cycle in G2/M, and trigger apoptosis in human adrenal carcinoma cell cultures.
18484097 Loss of p16/Rb protein expression and overexpression of cyclin D1/CDK4 were observed in 49%/40% and 37%/37% of gastric carcinomas, respectively.Cyclin D1 and CDK4 overexpession was inversely associated with lymph node metastasis and depth of invasion.
18483394 miR-16-1 regulates CCND1 mRNA expression; role of miR-16-1 in the regulation of CCND1 in MCL
18483258 ADAM17 mediates the EGFR/AKT/cyclin D1 pathway and cell cycle progression to the S phase induced by UVA radiation
18467434 GPR30-mediated inhibition of urothelial cell proliferation is the result of decreased cyclin D1 by down-regulation of activation protein-1 signaling.
18459109 Observational study of gene-disease association. (HuGE Navigator)
18456656 SOX2 and beta-catenin act in synergy in the transcription regulation of CCND1 in breast cancer cells
18445313 AP-1 activity and cyclin D1/E2F-1 expression in human embryo lung fibroblasts increased significantly after benzo(a)pyrene treatment.
18437417 Cyclin D1 is induced in HaCaT+ by BARF1 and is overexpressed in EBV-associated gastric cancer indicating an interaction of viral BARF1 and cyclin D1.
18431519 Data demonstrate that RNA interference of genes encoding cyclin D1 and cyclin D2 (CCND1 and CCND2, respectively) inhibits proliferation and is progressively cytotoxic in human myeloma cells.
18413827 Observational study of gene-disease association. (HuGE Navigator)
18413773 Id1 may contribute to early breast cancer by promoting excessive proliferation through cyclin D1.
18413728 Genomic aberrations of Cyclin D1 in neuroblastoma indicate that dysregulation of the G(1) entry checkpoint is an important cell cycle aberration in this pediatric tumor.
18413612 EWS-FLI1 directly stimulates cyclin D1 gene transcription.
18406353 miR-34a reduces both mRNA and protein levels of cyclin D1 (CCND1) and cyclin-dependent kinase 6 (CDK6).
18404250 Thus, an acidic environment triggers cytoplasmic localization and proteasomal degradation of cyclin D1.
18398822 11q23 deletion along with relatively strong CCND1 expression was common in uremic hyperparathyroidism
18393977 gene copy numbers of CCND1 in breast cancers
18381935 Cyclin E and cyclin D1 expression distinguishes non-BRCA1/2 tumors from both sporadic and BRCA1- and BRCA2-associated tumors and may reflect different predisposition and pathogenesis in these groups.
18379871 Cyclin D1 as a very useful proliferative marker in meningiomas.
18373498 DnaJB6 is necessary for translocation of Slfn1 into the nucleus, where Slfn1 down-regulates cyclin D1, induces cell-cycle arrest and programmes a quiescent state of T-cells
18367547 Nerve growth factor induced the cyclin D1 promoter via Sp1, nuclear factor-kappaB, and cAMP-response element/activated transcription factor sites.
18361427 Observational study of gene-disease association. (HuGE Navigator)
18358634 Report overexpression of cyclin D1, D3, and p21 in renal carcinomas with Xp11.2 TFE3-gene fusion.
18355918 a reliable marker of gene aberration in plasma cell myeloma
18355450 The results indicate that the waiting time for onset of oncogenic virus-associated neoplasia in patients homozygous (GG) for CCND1 genotypes (52 years) was 12 years earlier in comparison with patients carrying AG or AA genotypes (60 years).
18355450 Observational study of gene-disease association. (HuGE Navigator)
18349392 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18349267 The CCND1 A870G polymorphism had consistent associations with survival outcomes in head and neck neoplasms.
18347178 Cyclin D1 expression is an independent poor prognostic factor in women with early-stage, hormone receptor-positive breast cancer who received adjuvant tamoxifen-based therapy.
18343791 A certain number of cyclin D1+ and CD5- diffuse large B-cell lymphomas exist that have structural aberrations at the CCND1 locus, including the t(11;14).
18341653 up-regulation of cyclin D1 by inflammatory factor-1 (AIF-1) pathway
18327303 tumor cell incubation with pioglitazone results in increased levels of p53 and p27 and decreased levels of cyclin D1
18327210 Cyclin D1 expression analysis in familial breast cancers may discriminate BRCAX from BRCA2-linked cases.
18306932 Analysis of the pattern of expression of these biomolecules showed increased p16-positive phenotypes and decreased cyclin D1- and pRB-positive phenotype among the invasive tumors compared to low-grade CIN lesions
18301453 Only FIGO stage, cyclin D1, p27 (Kip1) and Ki-67 are independent prognostic factors that might help in predicting outcome of cervical cancer patients.
18284543 Expression of cyclin D1 is accelerated independently of beta-catenin in ameloblastomas.
18281541 Observational study of gene-disease association. (HuGE Navigator)
18251939 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18251939 present study did not demonstrate a significant association between CCND1 genotype and oral squamous cell carcinoma
18240019 Cyclin D1 may mediate cell proliferation by different mechanisms in estrogen receptor (ER) positive and negative breast cancer.
18239461 These studies suggest the endogenous cyclin D1 promoter BRG-1 binding site functions as a molecular scaffold in the context of local chromatin upon which coactivators and corepressors are recruited to regulate cyclin D1.
18237245 polymorphic alleles of HER2 and CCND1 may not play an important role as genetic markers for breast cancer risk, but presence of Val allele may be useful for tumor prognosis.
18237245 Observational study of gene-disease association. (HuGE Navigator)
18226366 Observational study of gene-disease association. (HuGE Navigator)
18212742 metformin exerts an antitumoral effect in vitro and in vivo through a decrease of cyclin D1 level
18205772 Observational study of gene-disease association. (HuGE Navigator)
18197291 The results demonstrate that PI-3K/Akt-mediated cyclin D1 expression is at least one key event implicated in the arsenite human skin carcinogenic effect.
18196581 The CCND1 G870A polymorphism is not associated with the risk of CRC in the German population.
18196581 Observational study and meta-analysis of gene-disease association and gene-environment interaction. (HuGE Navigator)
18194538 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18194492 Observational study of gene-disease association. (HuGE Navigator)
18187454 Rac signaling to cyclin D1 is a crucial pro-proliferative effect of E-cadherin-mediated cell-cell adhesion
18182398 The A allele and AA genotype of CCND1 G870A polymorphism have a significant association with an increased risk of the uterine leiomyoma in obese Korean women.
18182398 Observational study of gene-disease association. (HuGE Navigator)
18180298 alternatively spliced cyclin D1 modulates p27KIP1 binding and cell migration
18174243 Observational study of gene-disease association. (HuGE Navigator)
18171527 MIF and cyclin D1 might be related to the growth and metastasis of hepatocellular carcinoma.
18079202 The Wnt pathway target gene cyclin D1 was found to be up-regulated specifically in the nonfunctioning pituitary tumors compared with controls at both mRNA and protein level, supportive of activation of the Wnt-beta-catenin pathway
18067636 investigate the status of Her2, EGFR and cyclin D1 in 95 primary breast carcinomas
18063576 PKR and PKR-like endoplasmic reticulum kinase induce the proteasome-dependent degradation of cyclin D1 via a mechanism requiring eukaryotic initiation factor 2alpha phosphorylation
18061526 CCND1 polymorphisms stand-in as cis-acting regulatory elements modulating its expression and cyclin D1 genotype and phenotype could provide valuable additional information regarding prognosis of oral cancer patients.
18061526 Observational study of gene-disease association. (HuGE Navigator)
18056951 cyclin D1 reactivity is a considerably better marker of replicative senescence than senescence-associated beta-galactosidase activity.
18047954 Tissue expression of cyclin D1 or E1 seems not to add independent prognostic value to standard features in patients with nonmuscle -invasive urothelial cell carcinoma of the bladder.
18043898 CCND1 G870A polymorphism makes a significant contribution to breast cancer with the preponderance of breast cancer in young women
18027856 polymorphic variant of Aurora A does not appear to be associated with variation in colorectal cancer risk in HNPCC, whereas there is a more complex relationship between the Cyclin D1 polymorphism and disease risk in HNPCC
18027856 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18024283 There was a positive correlation between TRAF2 and cyclin D1 expressions and the expression NF-kappaBp65 in the epithelial cells and lymphocytes in oral lichen planus.
18019405 high cyclin expression may contribute to deregulation of the cell cycle in bone and soft tissue tumors
18006821 HSPB8 is a candidate CDK-independent cyclin D1 target that can mediate its effects
18006686 Nuclear accumulation of CCND1 during S phase inhibits Cul4-dependent Cdt1 proteolysis and triggers p53-dependent DNA rereplication.
17960397 Report a potential association of variants in the CCND1 and CDH1 genes with familial colorectal cancer using a unique study design with phenotypic extremes.
17960397 Observational study of gene-disease association. (HuGE Navigator)
17941827 that Rac1 is an essential player for mediating the induction of cyclin D1 and p21(Cip1) by HRG in breast cancer cells
17935714 p53 is an indispensable component of cellular signaling system which is regulated by caveolin-1 expression, involving Akt activation and increase in cyclin D1, thereby promoting proliferation of breast cancer cells.
17934069 specific overexpression of Sox11 mRNA and nuclear protein in both cyclin D1-positive and - negative MCL may be useful for the diagnosis of MCL as a complement to cyclin D1 and also suggests a functional role for Sox11 in MCL.
17927853 The positive rate of Cyclin D1 was significantly higher in colorectal carcinoma, colorectal adenoma with malignancy, and colorectal adenoma than in normal colorectal mucosa.
17927591 roles for cyclin D1 in the development of PA and for cyclin D1 in the progression ofpleomorphic adenoma (PA) and carcinoma ex pleomorphic adenoma (CXPA) of parotid gland
17923265 Alteration of CCND1 in Chinese patients with breast carcinoma and its correlation with Ki-67, pRb, and p53.
17922974 CCND1/GAPDH mRNA levels were significantly higher in lung cancer with EGFR mutation than in lung cancer without EGFR mutation
17916995 A high correlation between MUC1 and cyclin D1 implies MUC1 involvement in the Wnt cascade functioning in a large subset of human papillary thyroid carcinoma and papillary microcarcinoma
17912028 This study aimed to explore, whether polymorphisms in BCL2, Cyclin D1, FAS, EGF and EGFR genes affect survival in a cohort of patients with squamous cell esophageal cancer treated with CT+RT with a view to identify the potential therapeutic targets.
17912028 Observational study of gene-disease association. (HuGE Navigator)
17908995 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17906980 Cyclin D1 showed significantly higher median expression in thyroid cancer patients with netastatic papillary microcarcinoma compared to those without, indicating a correlation to tumour aggressiveness.
17901853 Observational study of gene-disease association. (HuGE Navigator)
17901853 CCND1 polymorphism may be an early event in tumorigenesis, but it is not a reliable prognostic criterion.
17882269 role for D-type cyclins in the excessive basal-cell proliferation and perturbed keratinocyte differentiation in the psoriatic epidermis
17881732 ZO-2 down-regulates cyclin D1 transcription by interacting with the c-Myc/E box element and by recruiting histone deacetylase 1
17868090 Review of cyclin D1 and cyclin G and CDK acitivty and their roles in cancer pathogenesis, and their proteosomal degradation pathways as targets for cancer therapy
17855508 A431 cells expressing SIP1 along with exogenous cyclin D1 were highly invasive
17848143 p53 and Ki-67, but not bcl-2, cyclin D1 or HER-2 may have roles in the process of tumor genesis in non-small cell lung carcinoma
17804732 The tumor-promoting activity of cyclin D1 may be tissue specific.
17724472 Temporal control of cyclin D1 subcellular localization and proteolysis is critical for maintenance of homeostasis within the mammary epithelium of transgenic mice.
17720094 in angiosarcoma, significant correlation was seen between phosphorylated-STAT3 and cyclin D1 but not between phosphorylated Akt and cyclin D1
17698033 mahanine can reverse an epigenetically silenced gene, RASSF1A in prostate cancer cells by inhibiting DNMT activity that in turn down-regulates a key cell cycle regulator, cyclin D1
17695500 Ki-67 antibody and cyclin D1 overexpression seem to parallel each other, supporting the concept that cyclin D1 serves as a cell cycle activator in squamous cell carcinoma of the penis.
17693985 Levels of cyclin D1 gene expression were significantly higher in malignant thyroid tumours (papillary thyroid carcinoma, medullary thyroid carcinoma) compared to macroscopically unchanged thyroid tissue, follicular adenoma and/or nodular goitre groups.
17684142 Observational study of gene-disease association. (HuGE Navigator)
17653856 strong correlation between CCND1 amplification and its protein expression in breast cancer
17634024 The expression of cyclin D1 in hypopharyngeal squamous cell carcinoma was significantly higher than that in normal epithelium.
17629555 Predominance of the Delta3'UTR mRNA was associated with higher cyclin D1 levels in cases with t(11;14), but did not correlate with the proliferation rate, suggesting a different role of this isoform in MM.
17626745 There is co-expression of Cyclin D1 and BP1 in breast cancer. BP1 gene may promote the genesis of breast cancer through regulating the expression of Cyclin D1.
17616699 that an O(2)(*-) signaling pathway regulates NAC-induced G(1) arrest by decreasing cyclin D1 protein levels and increasing MnSOD activity
17616526 RbAp48-mediated transformation of HPV16 is probably because of the regulation by RbAp48 of tumor suppressors retinoblastoma and p53, apoptosis-related enzymes caspase-3 and caspase-8, E6, E7, cyclin D1 (CCND1), and c-MYC.
17607588 Cyclin Dl over expression was evident among all cases of mantle cell lymphoma and few cases of large B-cell lymphoma
17606765 Suberoylanilide hydroxamic acid caused a rapid decrease of cyclin D1 in mantle cell lymphoma by blocking the translation of cyclin D1 by inhibiting the phosphatidylinositol 3-kinase (PI3K)/Akt/mTOR/eIF4E-BP pathway, probably by PI3K inhibition
17606477 This study provides a molecular basis to support the correlation of IL-8 expression with that of cyclin D1 in human prostate cancer and suggests a mechanism by which this chemokine promotes cell proliferation.
17605237 Observational study of gene-disease association. (HuGE Navigator)
17600882 a significant proportion of pancreatic ductal adenocarcinomas is characterized by simultaneous protein alterations regarding p16 & cyclin D1 genes; this mechanism of genetic deregulation in cell cycle potentially explains in part the aggressive phenotype
17561354 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17561354 There appears to be an influence of CCND1 870AA genotypes on esophageal cancer phenotype, particularly with regard to tumor location, which supports the theory of prevalence of site-specific genetic alterations
17556661 a new role for YY1 as both an inducer of p53 instability in smooth muscle cells, and an indirect repressor of p21WAF1/Cip1 transcription, p21WAF1/Cip1-cdk4-cyclin D1 assembly and intimal thickening.
17549378 Overexpression of cyclin D1 is associated with head and neck squamous cell carcinomas
17525627 There are significant differences between Ki-67 indices and CCND1 expression among melanocytic lesions.
17524364 Taken together, our data suggest that Apr3 should play an important role in ATRA signal pathway.
17517369 Our results indicate that the down-regulation of CCND1 is an essential step for DBC2's growth suppression of cancer cells.
17509221 a frameshift mutation (G base deletion) at nucleotide 82 of codon 28 in exon 4 of the cyclin D1 gene in a case of glioblastoma multiform (WHO Grade IV) sample.
17499716 The function of cyclin D1b in cell cycle regulation was investigated, by generating B-cell lines displaying conditional expression of isoform b.
17486065 Amplification of CCND1 is associated with recurrence and tamoxifen resistance in postmenopausal breast cancer
17482347 cyclin D1 expression in human tumoral parathyroid cells is regulated by calcium sensing receptor activation
17447856 Observational study of gene-disease association. (HuGE Navigator)
17447856 findings suggested that the G870A polymorphism of cyclin D1 may contribute to susceptibility to gastric cancer in Korean men
17438373 PTEN/PI 3-kinase signaling and cyclin D1 control a novel pathway that regulates assembly of the SCF(SKP2) complex.
17437044 GSK3beta may induce G(1) cell cycle arrest in a cyclin D1-dependent fashion and therefore possibly play a growth-inhibitory role in A549 cells.
17427198 BCAR3 induces anti-estrogen resistance and augments transcription of the cyclin D1 promoter.
17409409 Observational study of gene-disease association. (HuGE Navigator)
17398034 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17393422 Interaction of MUC1 with CTNNB modulates cyclin D1 in H. pylori-induced stomach neoplasms.
17374178 The expression level of cyclin D1 and CDK4 protein increased in human embryonic lung fibroblasts treated with quartz.
17344214 CYCLIN D1 may be a target gene for leptin mediated growth stimulation of breast cancer cells and molecular mechanisms involve activated Stat3
17334399 Cyclin D1/cdk4-mediated phosphorylation of BRCA1 inhibits the ability of BRCA1 to be recruited to particular promoters in vivo.
17316413 There was a highly significant positive association between p27(KIP-1) and estrogen receptor/progesterone receptor (ER/PR) status and with p27(KIP-1) and cyclin D1 expression. A trend between cyclin A and PR status was also identified.
17310991 These findings uncover specific residues conferring ubiquitination of cyclin D1 and provide a mechanistic basis for proteasomal degradation of cyclin D1.
17308274 Observational study of gene-disease association. (HuGE Navigator)
17299095 genomic deletions in CCND1 create stable truncated cyclin D1 mRNAs that may have a role in progression of mantle cell lymphoma
17284370 Data suggest that trisomy 11 does not appear to directly cause CCND1 gene overexpression.
17278098 deregulated expression of BRCA1-IRIS is likely to reduce dependence on normal physiological growth stimuli
17240151 All grade II/III meningiomas showed increased expression of cyclin D1 and high proliferative activity, suggesting the combined expression of cyclin D1 and proliferation may define subgroups of meningiomas with a more aggressive biological behavior.
17207971 the p38 MAPK/NF-kappaB/cyclin D1 signaling pathway might participate in the oncogenesis of extramammary Paget's disease
17205132 FBXW8 plays an essential role in cancer cell proliferation through proteolysis of cyclin D1. It may present new opportunities to develop therapies targeting destruction of cyclin D1 or its regulator E3 ligase selectively.
17203214 cyclin D1 has a role in progression of germ cell tumors
17203162 eIF4E, along with VEGF and cyclin D1, has a role in translational regulation of proteins related to angiogenesis and growth
17198740 By comparing the expression of p53, cyclin D1, p16, hTERT, and TSP-1 in spontaneously regressing keratoacanthoma and squamous cell carcinoma, the changes in the expression of these proteins to specific stages of skin carcinogenesis, is defined.
17188136 p53 and Ki-67 were expressed with increasing frequency, and bcl-2, p21, and mdm-2 with decreasing frequency in thyroid carcinoma progression. p27 and cyclin D1 were expressed in <15% of cases, with a trend toward decreasing expression.
17139501 findings suggest that CDK4 cooperation with CCND1 may be involved in the progression of laryngeal tumors
17129455 Expression of membranous beta-catenin in salivary adenoid cystic carcinoma was down-regulated in most of the patients with lymph node metastasis.
17116943 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17116943 XRCC1-01, XRCC3-01, and CCND1-01 may be predictive of survival outcome in patients with metastatic breast cancer treated with DNA-damaging chemotherapy
17106256 cyclin D1 may have a central role in mediating invasion and metastasis of cancer cells by controlling Rho/ROCK signaling and matrix deposition of TSP-1 [review]
17090192 Alterations in adenomatous polyposis coli/beta-catenin pathway and cyclin D1 dysregulation may contribute to pathogenesis of pleuropulmonary desmoid tumors and solitary fibrous tumors.
17081987 SCF(FBX4-alphaB crystallin) is an E3 ubiquitin ligase that promotes ubiquitin-dependent degradation of Thr286-phosphorylated cyclin D1.
17080657 Cyclin D1 is expressed in several kinds of brain cells following brain contusion, especially in glial cells.
17070615 cyclin D1 overexpression is not a consequence of, but rather a pivotal element in the process of malignant transformation in the lung and other tissues. [REVIEW]
17067457 PTEN may down-regulate the expression of PIP3, and then down-regulate the expression of cyclin D1, which leads to the suppression of cell growth.
17060721 Cyclin D1 expression was not significantly different among 20% of esophageal dysplasia, 53% of esophageal squamous cell carcinoma and 20% of normal mucosa.
17046823 subcellular localization is modulated by GSK-3beta and DYRK1B by phosphorylation of Thr(288)
17022831 Alternatively spliced cyclin D1 mRNA isoforms a and b are expressed in mantle cell lymphoma (MCL) and multiple myeloma (MM). Cyclin D1b proteins are present in MCL, rarely in MM.
17018901 cyclin D1 may have a role in marginal zone lymphoma of mediastinum [case report]
17011980 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17011980 After adjustment for age, sex, and smoking status, the AG genotype was associated with an increased risk for overall lung cancer
16980615 DACH1 repressed cyclin D1 through a novel mechanism via a c-Jun DNA-binding partner, requiring the DACH1 alpha-helical DS domain which recruits corepressors to the local chromatin.
16959222 Curcumin treatment inhibited cyclin D1 mRNA expression in K562 chronic leukaemia cells.
16942622 The suppression of cyclin D1 levels during S phase is regulated by cell cycle position rather than signaling activity.
16940298 HBx and NF-kappaB2/BCL3 mediated-cyclin D1 up-regulation might play an important role in the HBx-mediated HCC development and progression
16924241 Expression of p27Kip1 in melanoma is regulated via cyclin D1 control of Cks1/Skp2-mediated proteolysis.
16916940 Cyclin D1 or cyclin D3 are differentially used in the distinct mitogenic stimulations by growth factors or TSH.
16912209 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16884382 Cyclin D1 overexpression is associated with endometrial carcinoma
16870553 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16865250 High levels of cyclin D1 expression is associated with salivary adenoid cystic carcinoma
16860316 novel signaling pathway links BRCA1-IRIS to cellular proliferation through c-Jun/AP1 nuclear pathway; finally, this culminates in the increased expression of the cyclin D1 gene
16843438 telomerase reverse transcriptase has a novel role in the modulation of cyclin D1 expression
16832876 Observational study of gene-disease association. (HuGE Navigator)
16829689 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16829689 association between this CCND1 genotype and colorectal cancer risk in the Singapore Chinese Health Study.
16820873 Pin1 expression is correlated with cyclinD1 expression and may have a role in esophageal squamous cell carcinoma
16815198 CCND1 amplification is uncommon and appears to be late event in the development of ethmoid sinus adenocarcinoma.
16804724 When the combinations of the variables were assessed in two separate multivariate models, the combined variables p21/Ki-67 or p21/cyclin D1 expression were independent predictors for overall survival.
16788380 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16783567 Observational study of gene-disease association. (HuGE Navigator)
16783567 Study evaluated associations odds ratios and 95% confidence intervals in polymorphisms of seven candidate genes in 1,172 non-Hodgkin lymphoma (NHL) cases and 982 population-based controls, the cyclin D1 splice variant G870A (rs603965) increased NHL risk.
16776827 cyclin D1 expression is deregulated in idiopathic pulmonary fibrosis through a RhoA dependent mechanism that influences lung fibroblast proliferation
16758952 Cyclin D1 expression was higher in benzo(a)pyrene treated embryo lung fibroblasts than in controls.
16732330 Cyclin D1 is often mutated in esophageal cancer. The mutations disrupt phosphorylation at Thr-286, causing its nuclear accumulation. An acidic residue in the C-terminus is needed for recognition & phosphorylation by glycogen synthase kinase-3 beta.
16723714 Cav-1-deficient mammary acini displayed increased ERalpha levels and enhanced sensitivity toward estrogen-stimulated growth, with specific up-regulation of cyclin D1
16705174 Cyclin D1 promotes cellular motility through inhibiting ROCK signaling and repressing the metastasis suppressor TSP-1.
16699726 ERK1/2, JNK1/2 and p38 mapk pathways are all required for B[a]P-induced G1/S transition
16691626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16691558 Observational study of gene-disease association. (HuGE Navigator)
16691558 Results indicate that individuals carrying the CCND1 GG genotype have increased risk for the development of nasopharyngeal carcinoma.
16690963 Mantle cell lymphoma should be very sensitive to targeted therapy aimed at functional inhibition of the cyclin D1/CDK4 complex.
16672066 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16645724 ionizing radiation is able to enhance cyclin D1 transcription induced by B[a]PDE, and NFAT3 is involved in the regulation of cyclin D1 transcription by B[a]PDE or B[a]PDE plus ionizing radiation
16644723 glucocorticoid receptor (GR) represses cyclin D1 via Tcf-beta-catenin
16638786 Observational study of gene-disease association. (HuGE Navigator)
16616093 Differences in oncoprotein expression between endometriotic and adenomyotic tissues provide further evidence that the pathogenesis of endometriosis is different from that of adenomyosis.
16614728 These findings suggest heterogeneous abnormalities of CCND and RB in cutaneous T-cell lymphomas, in which dysregulated CCND and RB1 may lead to impaired cell cycle control.
16614707 Cyclin D1 expression was not significantly different in normal cervix and in cervical cancer.
16601140 the subtype 2 receptor-mediated antiproliferative effect of SRIH on TT cell proliferation may be exerted through a decrease in cyclin D1 and cdk4 levels
16568089 expression is repressed by SUMO modification of Sam68
16552496 Observational study of gene-disease association. (HuGE Navigator)
16552496 Our study suggests that the effect of cyclin D1 gene polymorphism on colorectal cancer risk is only observed in males and AA/AG genotype of cyclin D1 gene is associated with a higher risk of colorectal cancer
16547504 Cyclin D1 overexpression alters the proliferation and differentiation behavior of HaCaT skin keratinocytes in organotypic co-cultures.
16508013 we identified ZONAB-responsive elements in cyclin D1 promoter, cyclin D1 expression is regulated by ZONAB
16507767 This study demonstrates for the 1st time the involvement of MAPK-cyclin D1-p21(cip)machinery during cell growth inhibition and apoptosis of human vascular smooth muscle cells induced by cysthationine gamma-lyase overexpression.
16495921 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16490596 an association with alcohol consumption and the CCND1 gene or protein levels, in both esophageal and gastric cancers
16488657 Observational study of gene-disease association. (HuGE Navigator)
16461912 These studies indicate that the altered AR regulatory capacity of cyclin D1b contributes to its association with increased prostate cancer risk and provide evidence of cyclin D1b-mediated transcriptional regulation.
16436505 Treatment with HIV-Tat and morphine activates extracellular signal-regulated kinase-1/2 (ERK1/2), upregulates p53 and p21 levels, and downregulates cyclin D1 and Akt levels in human fetal brain-derived neural precursor cells
16407831 TIMP-1-mediates cell-cycle arrest via cyclin D1 downregulation & p27KIP1 upregulation.
16406195 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16399423 Observational study of gene-disease association. (HuGE Navigator)
16343742 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16334487 level of cyclin D1 negatively correlates with the proliferation properties of leukemic cells
16328437 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16328437 data support the hypothesis that the CCND1 A870G polymorphism may increase the risk of colorectal cancer in our Indian population
16322291 Hypermethylation of cyclin d2 is asspciated with prostate tumorigenesis
16273238 Cyclin D1 expression may be a useful biomarker for assessing the risk of developing esophageal cancer.
16258756 Observational study of gene-disease association. (HuGE Navigator)
16258726 integrin-dependent signal transduction events regulate the expression of cyclin D1 during G1 phase [review]
16226824 p38 kinase activation is linked temporally with cyclin D1 expression after PH and appears to exert cell cycle control in the adult liver.
16207592 Observational study of gene-disease association. (HuGE Navigator)
16174239 expression of cyclin D1 and c-Myc in epithelial ovarian cancer reaffirms the notion that they are crucial components in the pathway of tumorigenesis
16172916 The binding of STAT5 to the cyclin D1 promotor might up regulate cyclin D1 expression in oral squamous cell carcinoma.
16166625 SMAR1 regulates cyclin D1 by modification of chromatin through the SIN3/histone deacetylase 1 complex
16163738 cyclin D1 nuclear localization has a role in cancer [review]
16163549 Observational study of gene-disease association. (HuGE Navigator)
16155412 STAT5b may mediate the transcriptional activation of cyclin D1 after hypoxic stimulation.
16142313 the Wnt signaling pathway plays an important role in carcinogenesis in intrahepatic cholangiocarcinomas through overexpression of its target genes, particularly cyclin D1
16131791 an activating mutation of the beta-catenin gene affected regulation of the cyclin D1 gene, resulting in the generation of intrathoracic sporadic desmoid tumor
16123218 cases of cyclin D1-negative mantle cell lymphoma (MCL) do exist and are part of the spectrum of MCL
16115225 Cyclin D1 expression was significantly associated with tumour size and lymph node metastases in thyroid papillary microcarcinoma.
16051426 Increased cyclin D1 expression seen when earlier and later stage esophageal carcinomas stages compared
15981100 Atypical teratoid/rhabdoid tumor can be misdiagnosed as a variety of tumors, including ependymoma that potentially harbors LOH 22q. Our data indicate that cyclin D1 is a target of hSNF5/INI1in primary tumors.
15971196 Observational study of gene-disease association. (HuGE Navigator)
15951563 cyclin D1 plays an important role in cellular proliferation and differentiation through regulation of p300.
15951302 levels of cyclin D1a and D1b alternative transcripts in mantle cell lymphoma may depend more on sample origin than on CCND1 polymorphism
15949570 Observational study of gene-disease association. (HuGE Navigator)
15943036 cyclin D1 was localized in cell nuclei
15923181 PKC-mediated exclusion of LIMK2 from the nucleus might be a mechanism to relieve suppression of cyclin D1 expression by LIMK2
15914210 Observational study of gene-disease association. (HuGE Navigator)
15900590 Identification of mantle cell lymphoma with low cyclin D1 3'UTR is important because it seems to be associated with shorter overall survival.
15896460 Observational study of gene-disease association. (HuGE Navigator)
15878868 exposure of cells to cadmium chloride results in cytotoxicity and cell death due to enhanced ubiquitination and consequent proteolysis of eIF4E protein, which in turn diminishes cellular levels of critical genes such as cyclin D1
15870300 TAF1-dependent histone acetylation facilitates transcription factor binding to the Sp1 sites, thereby activating cyclin D1 transcription and ultimately G(1)-to-S-phase progression
15863141 Observational study of gene-disease association. (HuGE Navigator)
15863141 CCND1 polymorphism is associated with an increased risk of endometrial cancer.
15862753 Observational study of gene-disease association. (HuGE Navigator)
15861516 To explore the potential prognostic value of cyclin D1 in invasive breast cancer
15856299 Amplification of Bcl-1 is associated with the development of uterine cervical carcinoma
15845652 Observational study of gene-disease association. (HuGE Navigator)
15845652 AA genotype does not affect breast cancer risk.
15824172 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15811121 Bcl-1 staining was similar in all benign keratoses.
15809880 cyclin D1 overexpression is associated with non-small cell lung cancer
15791567 data indicate that altered expression of beta-catenin may play an important role in oral cancer progression through increased proliferation and invasiveness under epidermal growth factor receptor (EGFR) activation but not mutation or cyclin D1 expression
15776189 marked expression in high-grade tumors supports its role in proliferative activity
15755896 Cyclin D1, D2, or D3 expression appears to be increased and/or dysregulated in virtually all MM tumors despite their low proliferative capacity
15754315 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15754315 An associative interaction between XPD protein and CCND1 genetic polymorphisms, tobacco exposure, and cancer risk.
15735724 activation in breast cancer cells is mediated by mayven
15734847 We expressed cyclin D1 in the beta-cells of mice and islet hyperplasia developed in a time-dependent manner.
15709184 Cyclin D1 may be a potential target for molecular intervention in patients with oropharyngeal squamous cell cancer.
15695117 Observational study of gene-disease association. (HuGE Navigator)
15684604 experiments suggest that both catalytic and non-catalytic functions of cyclin D1 can collaborate to inactivate pRb-mediated cell cycle exit
15668481 Observational study of gene-disease association. (HuGE Navigator)
15655836 Cyclin D1 may play a role in the early stage of gallbladder carcinoma.
15621754 expression level of cyclin D1 RNA in bone marrow cells is predictive of the phase evolution in Chronic myeloid leukemia
15580291 Endogenously released IGF-I leads to constitutive cyclin D1 expression in human neuroendocrine tumour cells.
15578074 Cyclin D1 protein is upregulated in epithelioid sarcoma, suggesting a role in the pathogenesis of epithelioid sarcoma and appears to be regulated by translational and/or post-translational mechanisms.
15558026 Cyclin D1 central domain could be exploited to develop novel prostate cancer therapeutics.
15557752 In colorectal cancer, the CCND1 copy number increase was neither associated with the tumor phenotype (stage and grade) nor with the tumor localization (colon, rectum or sigmoid colon).
15557280 overexpression of FAK promoted exit from G(1) in glioblastoma cells, enhanced expression of cyclins D1 and E while reducing expression of p27(Kip1) and p21(Waf1), and enhanced the kinase activity of the cyclin D1-cyclin-dependent kinase-4 (cdk4) complex
15551329 CCND1 alternate transcripts encode proteins with differing functions: CCND1(tra) encodes protein involved in regulating mitogen responsive, anchorage-dependent progression; CCND1(trb) modulates ability of cell to grow in anchorage-independent manner
15545188 CCND1 gains are early events in ovarian tumorogenesis.
15544931 estrogen receptor mediates cyclin D1 expression and growth of tamoxifen-resistant tumors.
15539430 cyclin D1 binding to the androgen receptor NH2-terminal domain inhibits activation function 2 association
15538282 Observational study of gene-disease association. (HuGE Navigator)
15513923 C-terminal sequences direct cyclin D1-CRM1 binding
15505422 Expression levels of CCND1 predict the cellular effects of mTOR inhibitors in ovarian carcinoma.
15498584 Tumor growth inhibition might be due to apoptosis caused by reduced cyclin D1 expression as revealed by immunohistochemical analysis of tumor samples.
15378006 regulation by SNIP1
15377668 Synthesis is regulated by combined activity of ErbB2 and FGFR-4 that involves S6K1-mediated translation.
15375804 Review of Cyclin D1 overexpression in squamous cell head and neck neoplasms resulting from abnormalities in chromosome 11q13.
15355984 Data suggest that cyclin D1-Cdk2 complexes mediate some of the transforming effects of cyclin D1 and demonstrate that the cyclin D1-Cdk2 fusion protein is a useful model to investigate the biological functions of cyclin D1-Cdk2 complexes.
15350626 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15297421 Cyclin D1, p53, and p21Waf1/Cip1 have roles in progression of serous epithelial ovarian cancer
15282324 Data show that CCND1 promoter activation by estrogens in human breast cancer cells is mediated by recruitment of a c-Jun/c-Fos/estrogen receptor alpha/progesterone receptor complex to the tetradecanoyl phorbol acetate-responsive element of the gene.
15245939 Observational study of gene-disease association. (HuGE Navigator)
15245939 The CCND1 variant A allele may recessively increase the risk of carcinoma in situ incidence in patients with superficial bladder cancer.
15239347 cyclin D1-positive tumors tend to have perineural invasion more frequently.lymph vessel invasion is another factor related to cyclin D1 reactivity of the cells.
15226187 results suggest a model where RNA polymerase II bound at IgH regulatory sequences can activate the cyclin D1 promoter by either long-range polymerase transfer or tracking
15225161 Observational study of gene-disease association. (HuGE Navigator)
15203873 Presence in bone marrow cells indicated diagnosis of multiple myeloma.
15153436 Up-regulation of cyclin D1 is observed early in tumor formation, implying a possible role in tumor initiation.
15138714 Fluorescent in situ hybridization (FISH) and molecular analyses demonstrated involvement of the BCL1/CCND1 locus in a three-way translocation
15133490 Observational study of gene-disease association. (HuGE Navigator)
15133490 The authors found a correlation between CCND1 genotype and the age of onset of hepatoblastoma.
15128059 overexpression may be involved in the formation of the giant cells and the pathogenesis of central giant cell granuloma
15090460 results indicate an effect of gene dosage as an alternative mechanism of cyclin D1 deregulation in MM
15063389 Observational study of gene-disease association. (HuGE Navigator)
15060836 The expression patterns of cyclin D1, cyclin E, p21/waf1 and p27/kip1 in inflammatory bowel disease (IBD) may indicate their contribution in epithelial cell turnover and their possible implication in IBD-related dysplasia-carcinoma.
15059606 cyclin D1 has a role in tumorigenesis through interaction with C/EBPbeta
14981950 Observational study of gene-disease association. (HuGE Navigator)
14966901 expression of Egr-1, c-fos and cyclin D1 varies in esophageal precancerous lesions and cancer tissues, suggesting an involvement of these genes in the development of esophageal carcinoma.
14767060 cyclin D1 accumulation in G(1) phase is regulated by calcineurin
14764597 cyclin D1 is inhibited by PPARgamma2 activation in hepatocytes via CREB-dependent and beta-catenin-independent pathways
14759115 There was no correlation between human papillomavirus status and cyclin D1 overexpression in human oropharyngeal squamous cell carcinoma.
14754892 cyclin D1/Cdk4 complexes are regulated by calcium/calmodulin-dependent protein kinase I
14720512 Cyclin D1 expression was evatuated in cell cycle responses to DNA mismatch repair-deficient cells upon methylation and UV-C damage.
14703063 Observational study of gene-disease association. (HuGE Navigator)
14701845 cyclin D1 binding to wild type Cdk4 is stimulated by Cdc37
14689059 Moderate amplification of the CCND1 gene in Paget's disease of breast
14688016 Observational study of gene-disease association. (HuGE Navigator)
14679024 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14679024 The CCND1 A870G polymorphism may increase risk for colorectal neoplasms.
14666699 In cervical cancers cyclin D3 may compensate for low levels of cyclin D1, whereas in corpus cancers both isoforms may contribute to the neoplastic phenotype.
14666673 The beta-catenin-cyclin D1 pathway might be involved in the growth of endometrial carcinomas.
14666635 Observational study of gene-disease association. (HuGE Navigator)
14666635 CCND1 G870A polymorphism has been reported as a genetic risk factor for some tumour types, it does not appear to be linked to the risk of breast and colorectal cancers.
14657069 Observational study of gene-disease association. (HuGE Navigator)
14657069 These data provide strong evidence that the CCND1 870A allele may be associated with colorectal cancer, and particularly with forms of the disease that result in severe morbidity and mortality.
14646596 significant difference in their biochemical properties between CDK4/cyclin D1 and CDK2/cyclin A affecting regulation of cellular RB function
14645576 stabilized by HSV-1 ICP0 through degradation of cdc34
14645506 transcriptional regulation of the key cell cycle regulator cyclin D1 and roles of both STAT5 and Oct-1 in this process
14612904 cyclin D1, besides growth pattern, is a prognostic marker for local recurrence in DCIS
14530270 cyclin D1 expression is regulated by Pak1 in mammary glands and tumors
12972956 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12965081 the Cyclin D1/E2F1 pathway may be involved in apoptotic death of bone marrow cells in myelodysplastic syndromes
12955092 our data indicate that mutations of CCND1, which probably render the protein insensitive to degradation, represent a previously unreported mechanism of cyclin D1 overexpression in human tumors in vivo
12937137 Localized to suprabasal cells of telogen bulge and anagen outer root sheath(ORS). May mediate proliferation of stem cells in bulge to more differentiated transient amplifying cells in the suprabasal ORS.
12930597 Study revealed a higher prevalence of both aberrant beta-catenin expression and cyclin D1 overexpression in papillary thyroid cancers around the Semipalatinsk nuclear test site than sporadic cases.
12921950 Up-Regulation of cyclin D1 and p21(Waf1/Cip1) is associated with differentiation of human myeloid leukemia cell lines
12917338 The cyclin D1 gene is overexpressed in human breast cancers and is required for oncogene-induced tumorigenesis
12917336 The data are consistent with an oncogenesis model in which a lack of PTEN fuels the cell cycle by increasing the nuclear availability of cyclin D1 through the Akt/PKB pathway.
12914697 Results describe how patterns of gene expression in human tumors have been deconvoluted to reveal a mechanism of action for the cyclin D1 oncogene.
12899785 Observational study of gene-disease association. (HuGE Navigator)
12896908 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12894561 Data may suggest a possible role of the overexpression of cyclin D1 in the tumorigenesis of uveal malignant melanoma.
12883749 Observational study of gene-disease association. (HuGE Navigator)
12883688 COX-2 or VEGF, but not cyclin D1 may play roles in breast cancer with poor prognosis
12825853 Cyclin D1 could be indirectly induced by ErbB signalling through p21. ER-mediated upregulation of cyclin D1 seems to be a possible mechanism of maintaining cell proliferation in DCIS in case of EGFR- and HER-2/neu-negativity.
12824903 Deregulation of cyclin D1 is associated with early stages of plasma cell dyscrasia
12808109 cyclin D1 transcription is repressed by p53 through down regulation of Bcl-3 and inducing increased association of the p52 NF-kappaB subunit with histone deacetylase 1
12807740 ccnd1 polymorphism is associated with early lung cancer and contributes to susceptibility to lung cancer
12778072 Presence is associated with high nuclear grade, large tumor size, and poor prognosis for glioma patients.
12761882 overexpression inhibits TNF-induced growth arrest
12759391 LPA may directly increase the level of cyclin D1 in ovarian cancer cells, increasing their proliferation.
12746453 Cyclin D1 splice variants have differential effects on localization, RB phosphorylation, and cellular transformation
12743597 Loss of von Hippel-Lindau protein causes cell density dependent deregulation of this protein through HIF.
12738746 Cyclin d1 overexpression sensitizes breast cancer cells to fenretinide
12707028 The activation of Stat 3 and the dysregulation of this protein are mutually exclusive events in multiple myeloma.
12694349 Observational study of gene-disease association. (HuGE Navigator)
12694349 This study demonstrates that the CCND1 genotype may confer different risks for buccal squamous cell carcinoma (BSCC) and non-BSCC.
12692418 These results indicate that the altered expression of beta-catenin, but not cyclin D1, in hepatocellular carcinoma may play an important role in tumor progression by stimulating tumor cell proliferation.
12680219 Cells overexpressing cdk4 or cyclin D1 exhibited nuclear features characteristic of apoptosis.
12673692 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12673692 cyclin D1 (G870A) polymorphism is associated with susceptibility to esophageal and gastric cardiac carcinoma
12634633 Cyclin G1 is frequently overexpressed in uterine leiomyoma in a p53-independent manner and that this abnormality could be attributed to the severe proliferation of human uterine leiomyomas.
12607604 Comparative study in the expression of p53, EGFR, TGF-alpha, and cyclin D1 in verrucous carcinoma, verrucous hyperplasia, and squamous cell carcinoma of head and neck region.
12606305 gastrin appears to exert its mitogenic effects on gastric adenocarcinoma, at least in part, through changes in cyclin D1 expression.
12601350 increases of cyclin D1, cyclin-dependent kinase 4, cyclin E, cyclin A, and Wee1 play an important role in the development of hepatocellular carcinoma from cirrhosis
12594215 retinoblastoma protein has cyclin D1-inducing activity that is abolished by adenovirus E1A and that involves multiple pocket sequences that are independently involved in cyclin D1 activation
12589056 cyclin D1 has a role in regulating mitogenic signaling with IKKalpha
12582032 Observational study of gene-disease association. (HuGE Navigator)
12569141 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12569141 The cyclin D1 A allele was associated with a diminished modulation of normal physiologic and treatment-induced decreased expression of cyclin D1.
12557224 Clonal aberrations of CCND1 together with high mRNA expression suggest a role for deregulated CCND1 activity in neuroblastoma tumorigenesis.
12554669 PRH, is a tissue-specific inhibitor of eIF4E-dependent cyclin D1 mRNA transport and growth
12539042 Treatment with HIV-Tat and morphine activates extracellular signal-regulated kinase-1/2 (ERK1/2), upregulates p53 and p21 levels, and downregulates cyclin D1 and Akt levels in human fetal brain-derived neural precursor cells
12515730 Mantle cell lymphomagenesis results not only from direct consequences of inappropriate cyclin D1 expression but also from the ability of overexpressed cyclin D1 to buffer physiologic changes in p27 levels, rendering p27 ineffective as a growth inhibitor.
12480939 cyclin D1 expression initiates an apoptotic signal inhibited by different levels of cellular Bcl-2 at two points
12455063 Observational study of gene-disease association. (HuGE Navigator)
12455063 AA genotype of cyclin d1 polymorphism is associated with increased risk of prostate cancer
12444551 CDK-independent transactivation of the estrogen receptor by cyclin D1 is, by itself, not sufficient to cause estradiol-independent growth of breast cancer cells. A vast overexpression of G1/S cyclins D1 A & E is able to do so by capturing CDK inhibitors.
12439750 gene expression induced by galectin-3
12394763 Beta-catenin mutations correlate with over expression of C-myc and cyclin D1 Genes in bladder cancer
12391146 Oct-1 potentiates CREB-dependent cyclin D1 transcriptional activity by a phospho-CREB and CREB binding protein-independent mechanism
12388769 These results indicate that estrogen-induced cyclin D(1) transcription can occur in HepG2 cells independently of the transcriptional activity of estrogen receptor.
12379776 Marked intratumoral heterogeneity of c-myc and this but not of c-erbB2 amplification in breast cancer
12376514 early use of oral contraceptives may be associated with subset of mammary tumors that overexpress cyclin D1
12364325 inhibition of GSK3beta activity appears to trigger nuclear accumulation of cyclin D1 and cell cycle progression
12241561 Treatment with HIV-Tat and morphine activates extracellular signal-regulated kinase-1/2 (ERK1/2), upregulates p53 and p21 levels, and downregulates cyclin D1 and Akt levels in human fetal brain-derived neural precursor cells
12237776 Amplifications of c-myc and CCND1 are associated with detrusor-muscle-invasive transitional cell carcinoma
12231535 Strong cyclin D1 mRNA overexpression was detected in mantle cell lymphomas, hairy cell leukemias,and multiple myelomas. Intermediate transcript levels were found in some multiple myelomas and hairy cell leukemias.
12209953 upregulation of cyclin D1 and Fra-1 in human colorectal adenocarcinomas is driven by abnormally expressed beta-catenin
12203362 The CCND1 gene was rarely amplified in ILC in spite of showing overexpression of the protein in 41% of tumors. Hence, unlike IDC, increase in gene dosage did not account for the protein excess.
12164325 Observational study of genotype prevalence. (HuGE Navigator)
12151312 These data suggest that PKCdelta attenuates cyclin D1 promoter activity via the regulation of three distinct cis-acting regulatory elements.
12150453 overexpression of cyclin D1 sensitizes MCF7 cells to treatment with taxol
12138206 Data suggest that one mechanism by which INI1/hSNF5 exerts its tumor suppressor function is by mediating the cell cycle arrest due to the direct recruitment of HDAC activity to the cyclin D1 promoter, causing its repression and G(0)-G(1) arrest.
12127555 Cyclin D1 expression in peripheral blood of 7 mantle-cell lymphoma pts was 1305.4 times higher than in 24 chronic B-cell lymphocytic leukemia pts.
12101670 regulates cell cycle
12097293 Identification of cyclin D1 and other novel targets for the von Hippel-Lindau tumor suppressor gene by expression array analysis and investigation of cyclin D1 genotype as a modifier in von Hippel-Lindau disease.
12096344 The cyclin D1 high and cyclin E high subgroups of breast cancer: separate pathways in tumorogenesis based on pattern of genetic aberrations and inactivation of the pRb node.
12067972 Constitutive activation of signal transducers and activators of transcription 3 correlates with cyclin D1 overexpression and may provide a novel prognostic marker in head and neck squamous cell carcinoma.
12048199 cyclin D1 is a novel ligand-independent co-repressor
12036951 Overexpression of Icat induces G(2) arrest and cell death in tumor cell mutants for adenomatous polyposis coli, beta-catenin, or Axin.
12036934 Cyclin D1 is a candidate oncogene in cutaneous melanoma.
12036906 VHL-mediated hypoxia regulation of cyclin D1 in renal carcinoma cells.
12024041 The RASSF1A tumor suppressor blocks cell cycle progression and inhibits cyclin D1 accumulation (RASSF1A)
12007188 Overexpression of cyclin D1 is found to be significantly correlated with increased chromosomal instability in patients with breast cancer.
12002755 The expression of MIB-1 and prognosis in cyclin D1(CyD1)+ and CyD1- mantle cell lymphoma (MCL)were studied and compared to B-CLL/SLL. The CyD1- group (nodal MCL and CLL/SLL) had a longer median survival time than the CyD1+ group (nodal MCL and MLP).
11992406 Activation of cyclin D1 and D2 promoters by human T-cell leukemia virus type I tax protein is associated with IL-2-independent growth of T cells
11986316 expression affected by estrogen receptors alpha and beta
11958128 Observational study of gene-disease association. (HuGE Navigator)
11958128 A/G polymorphism of CCND1 was associated with the susceptibility to NPC
11948404 Cyclopentenone causes cell cycle arrest and represses cyclin D1 promoter activity in MCF-7 breast cancer cells.
11935308 analysis of expression improves differentiation of mantle cells from other lymphoma cells
11923474 cyclin D1 may be a target gene for prolactin in normal lobuloalveolar development, as well as in the development and/or progression of mammary cancer.
11902820 Observational study of gene-disease association. (HuGE Navigator)
11896626 Observational study of gene-disease association. (HuGE Navigator)
11884610 Reversal of growth suppression by p107 via direct phosphorylation by cyclin D1/cyclin-dependent kinase 4
11872630 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11872630 This study was conducted to explore the association between the polymorphism and the susceptibility to and disease status of TCC of the bladder in 222 cases and 317 native Japanese controls
11870667 Cyclin D1 play important roles in esophageal carcinogenesis.
11860939 Lower expression of p16 protein and overexpression of Cyclin D1 protein may be considered as prognostic biomarkers to skin carcinogenesis.
11838966 TSG101 expression in gynecological tumors: relationship to cyclin D1, cyclin E, p53 and p16 proteins.
11836555 Immunohistochemistry of cyclin D1 and beta-catenin, and mutational analysis of exon 3 of beta-catenin gene in parathyroid adenomas
11815623 Endostatin causes G1 arrest of endothelial cells through inhibition of cyclin D1.
11813305 Observational study of gene-disease association. (HuGE Navigator)
11751903 The ability of p21(Cip1) to inhibit cyclin D1 nuclear export correlates with its ability to bind to Thr-286-phosphorylated cyclin D1 and thereby prevents cyclin D1.CRM1 association
11739785 TGFbeta and PTHrP control chondrocyte proliferation by activating cyclin D1 expression
11698342 Observational study of gene-disease association. (HuGE Navigator)
11696452 Observational study of gene-disease association. (HuGE Navigator)
11642719 expression is related to apoptosis in thymus
11470749 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEE      1 - 70
QKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQM     71 - 140
ELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVA    141 - 210
AVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEE    211 - 280
VDLACTPTDVRDVDI                                                           281 - 295
//

Text Mined References (1193)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27025456 2016 Discovery and characterization of a novel CCND1/MRCK gene fusion in mantle cell lymphoma.
26997441 2016 BRAF inhibitor therapy-associated melanocytic lesions lack the BRAF V600E mutation and show increased levels of cyclin D1 expression.
26884359 2016 Genetic predisposition to ductal carcinoma in situ of the breast.
26834014 2016 PGC-1? regulates the cell cycle through ATP and ROS in CH1 cells.
26815661 2016 Survivin and cycline D1 expressions are associated with malignant potential in mucinous ovarian neoplasms.
26791264 2016 Elevated HOXA1 expression correlates with accelerated tumor cell proliferation and poor prognosis in gastric cancer partly via cyclin D1.
26728382 2016 [High expression of cyclin D1 is correlated with the expression of estrogen receptor and good prognosis in breast cancer].
26708419 2016 The anti-diabetic drug metformin inhibits pancreatic cancer cell proliferation in vitro and in vivo: Study of the microRNAs associated with the antitumor effect of metformin.
26708311 2016 Effects of CD73 on human colorectal cancer cell growth in vivo and in vitro.
26707131 2016 Antitumor activity of rhein lysinate against human glioma U87 cells in vitro and in vivo.
26681199 2015 Negative effect of cyclin D1 overexpression on recurrence-free survival in stage II-IIIA lung adenocarcinoma and its expression modulation by vorinostat in vitro.
26530115 2016 FH535 suppresses the proliferation and motility of hepatocellular carcinoma cells.
26510683 2015 Cyclin D1 in pediatric neuroblastic tumors: A microarray analysis.
26497080 2016 Cell motility and spreading promoted by CEACAM6 through cyclin D1/CDK4 in human pancreatic carcinoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26416848 2015 Adenosine Attenuates Human Coronary Artery Smooth Muscle Cell Proliferation by Inhibiting Multiple Signaling Pathways That Converge on Cyclin D.
26416047 Genetic polymorphisms in cell cycle regulatory genes CCND1 and CDK4 are associated with susceptibility to breast cancer.
26363896 2015 Cyclin D1 and Ewing's sarcoma/PNET: A microarray analysis.
26352175 2015 Downregulation of microRNA?33a promotes cyclin?dependent kinase 6, cyclin D1 and PIM1 expression and gastric cancer cell proliferation.
26344002 2015 Effect of fenhexamid and cyprodinil on the expression of cell cycle- and metastasis-related genes via an estrogen receptor-dependent pathway in cellular and xenografted ovarian cancer models.
26337082 2015 Functional, chemical genomic, and super-enhancer screening identify sensitivity to cyclin D1/CDK4 pathway inhibition in Ewing sarcoma.
26261659 2015 Detection of t(12;14)(p13;q32) in a patient with IGH-CCND1 negative mantle cell lymphoma resembling ultra-high risk chronic lymphocytic leukemia.
26253946 2015 RNAi-mediated silencing of Anxa2 inhibits breast cancer cell proliferation by downregulating cyclin D1 in STAT3-dependent pathway.
26247679 2015 Thrombin promotes the expression of Ccnd1 gene in RPE cells through the activation of converging signaling pathways.
26246306 2015 Cyclin D1 Loss Distinguishes Prostatic Small-Cell Carcinoma from Most Prostatic Adenocarcinomas.
26233522 2015 Coexpression of cyclin D1 and alpha-internexin in oligodendroglial tumors.
26206533 2016 CyclinD1 Down-Regulation and Increased Apoptosis Are Common Features of Cohesinopathies.
26200099 2015 Microcystic Stromal Tumor: A Distinctive Ovarian Sex Cord-Stromal Neoplasm Characterized by FOXL2, SF-1, WT-1, Cyclin D1, and ?-catenin Nuclear Expression and CTNNB1 Mutations.
26172301 2015 Multifaceted interactions and regulation between antizyme and its interacting proteins cyclin D1, ornithine decarboxylase and antizyme inhibitor.
26151768 2015 Roscovitine has anti-proliferative and pro-apoptotic effects on glioblastoma cell lines: A pilot study.
26150472 2015 CCND1-CDK4-mediated cell cycle progression provides a competitive advantage for human hematopoietic stem cells in vivo.
26137545 2015 Cyclin D1 Again Caught in the Act: Dyrk1a Links G1 and Neurogenesis in Down Syndrome.
26133979 2015 Knockdown of zinc transporter ZIP5 (SLC39A5) expression significantly inhibits human esophageal cancer progression.
26129688 2015 Epigenetically altered miR-193b targets cyclin D1 in prostate cancer.
26125784 2015 Cyclin D1 G870A polymorphism is associated with an increased risk of multiple myeloma.
26125710 2015 Cyclin D1 G870A gene polymorphism and risk of leukemia and hepatocellular carcinoma: a meta-analysis.
26124325 2015 MMP9, Cyclin D1 and ?-Catenin Are Useful Markers of p16-positive Squamous Cell Carcinoma in Therapeutic EGFR Inhibition In Vitro.
26121043 2015 Resibufogenin Induces G1-Phase Arrest through the Proteasomal Degradation of Cyclin D1 in Human Malignant Tumor Cells.
26111591 2015 Marine steroids as potential anticancer drug candidates: In silico investigation in search of inhibitors of Bcl-2 and CDK-4/Cyclin D1.
26101806 2015 ATF7 is stabilized during mitosis in a CDK1-dependent manner and contributes to cyclin D1 expression.
26067621 2015 DNA methylation fingerprint of neuroblastoma reveals new biological and clinical insights.
26055143 2015 Association of CCND1 overexpression with KRAS and PTEN alterations in specific subtypes of non-small cell lung carcinoma and its influence on patients' outcome.
26055066 2015 The subcellular distribution of cyclin-D1 and cyclin-D3 within human islet cells varies according to the status of the pancreas donor.
26047605 2015 MiR-503 inhibited cell proliferation of human breast cancer cells by suppressing CCND1 expression.
25998224 2015 Knockdown of ILK inhibits glioma development via upregulation of E-cadherin and downregulation of cyclin D1.
25991665 2015 Nuclear localization of epidermal growth factor receptor (EGFR) in ameloblastomas.
25985117 2015 A systematic investigation based on microRNA-mediated gene regulatory network reveals that dysregulation of microRNA-19a/Cyclin D1 axis confers an oncogenic potential and a worse prognosis in human hepatocellular carcinoma.
25971210 2015 Overexpression of microRNA-95-3p suppresses brain metastasis of lung adenocarcinoma through downregulation of cyclin D1.
25940700 2015 Kinase-independent role of cyclin D1 in chromosomal instability and mammary tumorigenesis.
25939703 2015 JARID2 inhibits leukemia cell proliferation by regulating CCND1 expression.
25925673 2015 Statin-induced anti-proliferative effects via cyclin D1 and p27 in a window-of-opportunity breast cancer trial.
25907675 2015 Cyclin D1 in well differentiated thyroid tumour of uncertain malignant potential.
25889927 2015 miR-211 suppresses epithelial ovarian cancer proliferation and cell-cycle progression by targeting Cyclin D1 and CDK6.
25888980 2015 Effect of the CCND1 A870G polymorphism on prostate cancer risk: a meta-analysis of 3,820 cases and 3,825 controls.
25881299 2015 Cyclin D1 sensitizes myeloma cells to endoplasmic reticulum stress-mediated apoptosis by activating the unfolded protein response pathway.
25879784 2015 Altered PPP2R2A and Cyclin D1 expression defines a subgroup of aggressive luminal-like breast cancer.
25869879 2015 The high expression of TC1 (C8orf4) was correlated with the expression of ?-catenin and cyclin D1 and the progression of squamous cell carcinomas of the tongue.
25851350 2015 Influence of CCND1 G870A polymorphism on the risk of HBV-related HCC and cyclin D1 splicing variant expression in Chinese population.
25823925 2015 MicroRNA profiling identifies MiR-195 suppresses osteosarcoma cell metastasis by targeting CCND1.
25817794 2015 miR-340 inhibits glioblastoma cell proliferation by suppressing CDK6, cyclin-D1 and cyclin-D2.
25809706 2015 The significant association of CCND1 genotypes with colorectal cancer in Taiwan.
25787974 2015 Consequence of the tumor-associated conversion to cyclin D1b.
25779425 2015 Enterovirus 71 induces apoptosis of SH?SY5Y human neuroblastoma cells through stimulation of endogenous microRNA let-7b expression.
25765113 Cyclin D1 in human neuroblastic tumors recapitulates its developmental expression: An immunohistochemical study.
25765111 Cyclin D1 is a useful marker for soft tissue Ewing's sarcoma/peripheral Primitive Neuroectodermal Tumor in children and adolescents: A comparative immunohistochemical study with rhabdomyosarcoma.
25751590 Novel Karyotypes and Cyclin D1 Immunoreactivity in Clear Cell Sarcoma of the Kidney.
25744732 2015 Downregulation of telomerase activity by diclofenac and curcumin is associated with cell cycle arrest and induction of apoptosis in colon cancer.
25712050 2015 Hepatitis B Virus X Protein Stabilizes Cyclin D1 and Increases Cyclin D1 Nuclear Accumulation through ERK-Mediated Inactivation of GSK-3?.
25702703 2015 DICER1 regulated let-7 expression levels in p53-induced cancer repression requires cyclin D1.
25663615 2015 The diagnostic value of 11q13 amplification and protein expression in the detection of nodal metastasis from oral squamous cell carcinoma: a systematic review and meta-analysis.
25659037 2015 WWOX suppresses prostate cancer cell progression through cyclin D1-mediated cell cycle arrest in the G1 phase.
25645517 2015 Expression and inactivation of glycogen synthase kinase 3 alpha/ beta and their association with the expression of cyclin D1 and p53 in oral squamous cell carcinoma progression.
25596256 2015 Cyclin D1-positive diffuse large B-cell lymphoma with IGH-CCND1 translocation and BCL6 rearrangement: a report of two cases.
25556515 2015 Diffuse and strong cyclin D1 immunoreactivity in clear cell sarcoma of the kidney.
25556372 2015 MicroRNA-576-3p inhibits proliferation in bladder cancer cells by targeting cyclin D1.
25550842 2014 Dual high expression of STAT3 and cyclinD1 is associated with poor prognosis after curative resection of esophageal squamous cell carcinoma.
25511212 Cyclin D1 and Ki-67 expression in normal, hyperplastic and neoplastic endometrium.
25502086 2015 Overexpression of cyclin D1 in meningioma is associated with malignancy grade and causes abnormalities in apoptosis, invasion and cell cycle progression.
25501285 2015 Cell cycle marker expression in benign and malignant intraductal papillary lesions of the breast.
25486477 2014 The cyclin D1-CDK4 oncogenic interactome enables identification of potential novel oncogenes and clinical prognosis.
25470788 2015 Cyclin D1 is a strong prognostic factor for survival in pancreatic cancer: analysis of CD G870A polymorphism, FISH and immunohistochemistry.
25452171 2015 Prognostic value of differential CCND1 expression in patients with resected gastric adenocarcinoma.
25450356 2014 MicroRNA-383 inhibits anchorage-independent growth and induces cell cycle arrest of glioma cells by targeting CCND1.
25437003 2014 Growth inhibition of head and neck squamous cell carcinoma cells by sgRNA targeting the cyclin D1 mRNA based on TRUE gene silencing.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416956 2014 A proteome-scale map of the human interactome network.
25409185 2014 Cyclin D1 G870A polymorphism and risk of nasopharyngeal carcinoma: a case-control study and meta-analysis.
25399071 2014 Genetic association between cyclin D1 polymorphism and breast cancer susceptibility.
25358426 2014 Bcl1 polymorphism of the glucocorticoid receptor gene and treatment response to milnacipran and fluvoxamine in Japanese patients with depression.
25339094 2014 Lefty inhibits in vitro decidualization by regulating P57 and cyclin D1 expressions.
25337233 2014 Correlation of RKIP, STAT3 and cyclin D1 expression in pathogenesis of gastric cancer.
25322986 2014 DACH1 inhibits cyclin D1 expression, cellular proliferation and tumor growth of renal cancer cells.
25313758 Cyclin D1 expression in ductal carcinoma of the breast and its correlation with other prognostic parameters.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25231129 2014 Biphasic ER-?36-mediated estrogen signaling regulates growth of gastric cancer cells.
25227811 2014 A cyclin D1 (CCND1) gene polymorphism contributes to susceptibility to papillary thyroid cancer in the Turkish population.
25202078 2014 The significant association of CCND1 genotypes with gastric cancer in Taiwan.
25193465 2014 Cyclin D1b splice variant promotes ?v?3-mediated adhesion and invasive migration of breast cancer cells.
25169547 2014 The CCND1 G870A gene polymorphism and leukemia or non-Hodgkin lymphoma risk: a meta-analysis.
25146682 2014 Contribution of cyclin D1 (CCND1) and E-cadherin (CDH1) alterations to colorectal cancer susceptibility: a case-control study.
25142862 2015 PSAT1 regulates cyclin D1 degradation and sustains proliferation of non-small cell lung cancer cells.
25135222 2014 TIP30 nuclear translocation negatively regulates EGF-dependent cyclin D1 transcription in human lung adenocarcinoma.
25128069 2014 Transcription factor OCT4 promotes cell cycle progression by regulating CCND1 expression in esophageal carcinoma.
25120779 2014 Cyclin D1b overexpression inhibits cell proliferation and induces cell apoptosis in cervical cancer cells in vitro and in vivo.
25120774 2014 Possible prognostic significance of p53, cyclin D1 and Ki-67 in the second primary malignancy of patients with double primary malignancies.
25106503 2014 The expression of HER-2/neu (c-erbB2), survivin and cycline D1 in serous ovarian neoplasms: their correlation with clinicopathological variables.
25081680 2014 Association of cyclin D1 variants with head and neck cancer susceptibility: evidence from a meta-analysis.
25073953 2014 Colocalization of ?-catenin with Notch intracellular domain in colon cancer: a possible role of Notch1 signaling in activation of CyclinD1-mediated cell proliferation.
25053516 2014 Cyclin D1, p16(INK) (4A) and p27(Kip1) in pancreatic adenocarcinoma: assessing prognostic implications through quantitative image analysis.
25022375 Prognostics of Cyclin-D1 expression with chemoradiation response in patients of locally advanced oral squamous cell carcinoma.
25017118 2014 Galanin receptor 2 utilizes distinct signaling pathways to suppress cell proliferation and induce apoptosis in HNSCC.
25015333 2014 Prognostic significance of miR-34a in Ewing sarcoma is associated with cyclin D1 and ki-67 expression.
24995320 2014 MiR-15b targets cyclin D1 to regulate proliferation and apoptosis in glioma cells.
24929480 2014 Neoplasms arising in large gastric hyperplastic polyps: endoscopic and pathologic features.
24914206 2014 Differential regulation of cyclin D1 expression by protein kinase C ? and ? signaling in intestinal epithelial cells.
24912680 2014 Cyclin D1 and C/EBP? LAP1 operate in a common pathway to promote mammary epithelial cell differentiation.
24885829 2014 Associations of hormone replacement therapy and oral contraceptives with risk of colorectal cancer defined by clinicopathological factors, beta-catenin alterations, expression of cyclin D1, p53, and microsatellite-instability.
24885594 2014 Discrepant alterations in main candidate genes among multiple primary melanomas.
24876129 2014 Cyclin D activates the Rb tumor suppressor by mono-phosphorylation.
24870800 2014 A functional SNP in the MDM2 promoter mediates E2F1 affinity to modulate cyclin D1 expression in tumor cell proliferation.
24870765 2014 The CCND1 G870A gene polymorphism and brain tumor risk: a meta-analysis.
24862872 2016 Cyclin D1 gene amplification is highly homogeneous in breast cancer.
24858206 2014 Sohlh2 inhibits ovarian cancer cell proliferation by upregulation of p21 and downregulation of cyclin D1.
24855949 2014 A code for RanGDP binding in ankyrin repeats defines a nuclear import pathway.
24840634 2014 Association between the G870A polymorphism of Cyclin D1 gene and glioma risk.
24830723 2014 Cyclin D1 integrates estrogen-mediated DNA damage repair signaling.
24809775 2014 Anterior tongue cancer with no history of tobacco and alcohol use may be a distinct molecular and clinical entity.
24806449 2014 The Down syndrome-related protein kinase DYRK1A phosphorylates p27(Kip1) and Cyclin D1 and induces cell cycle exit and neuronal differentiation.
24792491 2014 FRK suppresses the proliferation of human glioma cells by inhibiting cyclin D1 nuclear accumulation.
24780198 2014 JunB/cyclin-D1 imbalance in placental mesenchymal stromal cells derived from preeclamptic pregnancies with fetal-placental compromise.
24777966 2013 Spontaneous peripheral T-cell responses toward the tumor-associated antigen cyclin D1 in patients with clear cell renal cell carcinoma.
24774443 2014 YB-1 promotes transcription of cyclin D1 in human non-small-cell lung cancers.
24746206 2014 Aberrant expression of p53, p21, cyclin D1, and Bcl2 and their clinicopathological correlation in ampullary adenocarcinoma.
24739041 2014 SGK3 is an androgen-inducible kinase promoting prostate cancer cell proliferation through activation of p70 S6 kinase and up-regulation of cyclin D1.
24737585 2014 Cyclin D1 (CCND1) G870A polymorphisms and cervical cancer susceptibility: a meta-analysis based on ten case-control studies.
24728073 2014 Prognostic significance of cyclin D1 expression in colorectal cancer: a meta-analysis of observational studies.
24722063 2014 Clinical, morphologic, phenotypic, and genetic evidence of cyclin D1-positive diffuse large B-cell lymphomas with CYCLIN D1 gene rearrangements.
24675814 2014 Cyclin D1 overexpression is associated with poor clinicopathological outcome and survival in oral squamous cell carcinoma in Asian populations: insights from a meta-analysis.
24662605 2014 GM-CSF induces cyclin D1 expression and proliferation of endothelial progenitor cells via PI3K and MAPK signaling.
24615109 2014 Association of cyclin D1 and survivin expression with sensitivity to radiotherapy in patients with nasopharyngeal carcinoma.
24610618 2014 Expression of cyclinD1 and Ki-67 proteins in gliomas and its clinical significance.
24606123 2014 Progesterone receptor-cyclin D1 complexes induce cell cycle-dependent transcriptional programs in breast cancer cells.
24583467 2014 Nuclear accumulation of cyclin D1 following long-term fractionated exposures to low-dose ionizing radiation in normal human diploid cells.
24570185 2014 Cyclin D1 G870A polymorphism and the risk of hepatocellular carcinoma in a Chinese population.
24510244 2014 Copy number variation in CCND1 gene is implicated in the pathogenesis of sporadic parathyroid carcinoma.
24505359 2014 MicroRNA-545 suppresses cell proliferation by targeting cyclin D1 and CDK4 in lung cancer cells.
24499623 2013 Epstein-Barr Virus encoded LMP1 regulates cyclin D1 promoter activity by nuclear EGFR and STAT3 in CNE1 cells.
24493630 2014 A genome-wide association study of early-onset breast cancer identifies PFKM as a novel breast cancer gene and supports a common genetic spectrum for breast cancer at any age.
24470282 2014 Prognostic significance of cyclin D1 and E-cadherin expression in laryngeal squamous cell carcinoma.
24468132 2014 Cyclin D1 amplification in multiple myeloma is associated with multidrug resistance expression.
24460344 2013 Association of the Cylin D1 G870A polymorphism with laryngeal cancer: are they really related?
24458211 2014 Clinical impact of predicting CCND1 amplification using plasma DNA in superficial esophageal squamous cell carcinoma.
24452204 2014 Perinucleolar relocalization and nucleolin as crucial events in the transcriptional activation of key genes in mantle cell lymphoma.
24448750 2014 High NF-?B and STAT3 activity in human urothelial carcinoma: a pilot study.
24440705 2014 MicroRNA-490-3p inhibits proliferation of A549 lung cancer cells by targeting CCND1.
24427347 2014 Overexpression of ?-catenin and cyclinD1 predicts a poor prognosis in ovarian serous carcinomas.
24425835 Chemoprevention by celecoxib and mutagen sensitivity of cyclin d1 in patients with oropharyngeal carcinoma.
24403468 2014 Lack of evidence for predictive and prognostic value of cyclin D1 gene polymorphism CCND1 G870A for oral squamous cell carcinoma.
24390237 2014 AngiotensinII induces HuR shuttling by post-transcriptional regulated CyclinD1 in human mesangial cells.
24352646 2014 Distinction between asymptomatic monoclonal B-cell lymphocytosis with cyclin D1 overexpression and mantle cell lymphoma: from molecular profiling to flow cytometry.
24342356 2014 SUMOylation of RhoGDI? is required for its repression of cyclin D1 expression and anchorage-independent growth of cancer cells.
24324055 2013 Expression of cyclin d1 and its association with disease characteristics in bladder cancer.
24292672 2014 Nuclear loss of protein arginine N-methyltransferase 2 in breast carcinoma is associated with tumor grade and overexpression of cyclin D1 protein.
24289491 2014 MicroRNA-206 induces G1 arrest in melanoma by inhibition of CDK4 and Cyclin D.
24287487 2013 Cyclin D1 induction of Dicer governs microRNA processing and expression in breast cancer.
24282282 2014 Identification of a cyclin D1 network in prostate cancer that antagonizes epithelial-mesenchymal restraint.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24264314 2014 Association between CCND1 and XPC polymorphisms and bladder cancer risk: a meta-analysis based on 15 case-control studies.
24248414 2014 miR-449a Regulates proliferation and chemosensitivity to cisplatin by targeting cyclin D1 and BCL2 in SGC7901 cells.
24222746 2013 Cyclin D1 G870A polymorphism and risk of nasopharyngeal carcinoma: a meta-analysis.
24218572 2013 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
24214587 2013 Peculiarities of cyclin D1 expression in reproductive and menopausal women with cervical hyperkeratosis.
24186074 2014 Association between Cyclin D1 polymorphism and oral cancer susceptibility: a meta-analysis.
24145651 2014 Mammary analogue secretory carcinoma of salivary glands with high-grade transformation: report of 3 cases with the ETV6-NTRK3 gene fusion and analysis of TP53, ?-catenin, EGFR, and CCND1 genes.
24143218 2013 NOTCH3 is a prognostic factor that promotes glioma cell proliferation, migration and invasion via activation of CCND1 and EGFR.
24134204 2014 A novel DYRK1B inhibitor AZ191 demonstrates that DYRK1B acts independently of GSK3? to phosphorylate cyclin D1 at Thr(286), not Thr(288).
24133584 2013 Upregulation of ATF-3 is correlated with prognosis and proliferation of laryngeal cancer by regulating Cyclin D1 expression.
24121026 2014 T3 enhances thyroid cancer cell proliferation through TR?1/Oct-1-mediated cyclin D1 activation.
24119401 2013 Dosage of Dyrk1a shifts cells within a p21-cyclin D1 signaling map to control the decision to enter the cell cycle.
24107628 2013 Cyclin D1 is a major target of miR-206 in cell differentiation and transformation.
24088803 2013 Matrine promotes G0/G1 arrest and down-regulates cyclin D1 expression in human rhabdomyosarcoma cells.
24065533 2013 The HTLV-1 HBZ protein inhibits cyclin D1 expression through interacting with the cellular transcription factor CREB.
24060591 2013 Cyclin D1 (CCND1) messenger RNA expression as assessed by real-time PCR contributes to diagnosis and follow-up control in patients with mantle cell lymphoma.
24038789 2014 Stromal cell derived factor-1? promotes C-Kit+ cardiac stem/progenitor cell quiescence through casein kinase 1? and GSK3?.
24008375 2013 Metformin suppresses hepatocellular carcinoma cell growth through induction of cell cycle G1/G0 phase arrest and p21CIP and p27KIP expression and downregulation of cyclin D1 in vitro and in vivo.
23991964 2013 MicroRNA-16 inhibits bladder cancer proliferation by targeting Cyclin D1.
23991960 2013 Cyclin D1 gene G870A variants and primary brain tumors.
23985254 2013 [Impact of CCND1 A870G polymorphism on acute adverse events in postoperative rectal cancer patients treated with adjuvant concurrent chemoradiotherapy].
23981302 2013 NF?B-mediated cyclin D1 expression by microRNA-21 influences renal cancer cell proliferation.
23975835 2014 Female-specific rectal carcinogenesis in cyclin D1b transgenic mice.
23949314 2014 Arsenic trioxide suppressed mantle cell lymphoma by downregulation of cyclin D1.
23947899 2013 CyclinD1, a prominent prognostic marker for endometrial diseases.
23938323 2013 Cooperation between Dmp1 loss and cyclin D1 overexpression in breast cancer.
23936312 2013 WT1 promotes cell proliferation in non-small cell lung cancer cell lines through up-regulating cyclin D1 and p-pRb in vitro and in vivo.
23928935 2013 Expression of ?-catenin and cyclin D1 in Merkel cell carcinomas of the head and neck.
23920145 2013 Oxidative stress-induced cyclin D1 depletion and its role in cell cycle processing.
23898488 2013 Relationship between cyclin D1 (A870G) gene polymorphism and lung cancer.
23897809 2013 Cyclin D1 promotes cell cycle progression through enhancing NDR1/2 kinase activity independent of cyclin-dependent kinase 4.
23893383 2014 The CCND1 G870A polymorphism and susceptibility to bladder cancer.
23887292 2014 CCND1/CyclinD1 status in metastasizing bladder cancer: a prognosticator and predictor of chemotherapeutic response.
23873109 2013 The cyclin D1 (CCND1) G870A polymorphism and lung cancer susceptibility: a meta-analysis.
23864650 2013 Cyclin D1 determines estrogen signaling in the mammary gland in vivo.
23861098 2013 Tissue aluminum concentration does not affect the genomic stability of ERBB2, C-MYC, and CCND1 genes in breast cancer.
23852369 2013 MEK drives cyclin D1 hyperelevation during geroconversion.
23839043 2013 Cell cycle regulators cyclin D1 and CDK4/6 have estrogen receptor-dependent divergent functions in breast cancer migration and stem cell-like activity.
23839032 2013 Cyclin D1 localizes in the cytoplasm of keratinocytes during skin differentiation and regulates cell-matrix adhesion.
23812426 2014 Post-transcriptional regulation of cyclins D1, D3 and G1 and proliferation of human cancer cells depend on IMP-3 nuclear localization.
23804702 2013 Cyclin G1 expands liver tumor-initiating cells by Sox2 induction via Akt/mTOR signaling.
23803020 2013 Cyclin D1, retinoblastoma and p16 protein expression in carcinoma of the gallbladder.
23795354 2013 [Characterization of genetic alterations in primary human melanomas carrying BRAF or NRAS mutation].
23794242 2013 Insulin induces C2C12 cell proliferation and apoptosis through regulation of cyclin D1 and BAD expression.
23786849 2013 Cyclin D1 cooperates with p21 to regulate TGF?-mediated breast cancer cell migration and tumor local invasion.
23741361 2013 Inhibition of UBE2D3 expression attenuates radiosensitivity of MCF-7 human breast cancer cells by increasing hTERT expression and activity.
23737530 2013 Nuclear factor of activated T cells c1 mediates p21-activated kinase 1 activation in the modulation of chemokine-induced human aortic smooth muscle cell F-actin stress fiber formation, migration, and proliferation and injury-induced vascular wall remodeling.
23733133 2013 Cyclin D1 harboring the T286I mutation promotes oncogenic activation in endometrial cancer.
23731275 2013 MicroRNA-503 suppresses proliferation and cell-cycle progression of endometrioid endometrial cancer by negatively regulating cyclin D1.
23720779 2013 X-linked inhibitor of apoptosis protein (XIAP) regulation of cyclin D1 protein expression and cancer cell anchorage-independent growth via its E3 ligase-mediated protein phosphatase 2A/c-Jun axis.
23696923 2013 KAI1/CD82 and cyclin D1 as biomarkers of invasion, metastasis and prognosis of laryngeal squamous cell carcinoma.
23692432 2013 Prognostic value of cyclin D1 expression in tumor-free surgical margins in head and neck squamous cell carcinomas.
23674142 2013 miR-449b inhibits the proliferation of SW1116 colon cancer stem cells through downregulation of CCND1 and E2F3 expression.