Property Summary

Ligand Count 2
NCBI Gene PubMed Count 1,283
PubMed Score 5737.32
PubTator Score 4570.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.00373686301306713
Kidney cancer 2613 0.0 1.4
Disease Target Count Z-score Confidence
Cancer 2499 7.62 3.8

Expression

  Differential Expression (21)

Disease log2 FC p
Breast cancer 1.100 3.7e-03
adult high grade glioma 1.300 2.6e-03
astrocytoma 1.200 1.8e-09
Astrocytoma, Pilocytic 2.100 8.5e-09
atypical teratoid / rhabdoid tumor 2.300 1.8e-03
colon cancer 1.400 1.7e-04
cystic fibrosis 1.148 2.5e-04
ependymoma 2.200 2.0e-07
glioblastoma 1.700 5.9e-04
group 3 medulloblastoma -1.300 6.0e-03
Hydrolethalus syndrome 1.674 3.7e-02
lung cancer 1.100 9.4e-03
malignant mesothelioma -1.600 2.0e-05
medulloblastoma, large-cell -1.100 2.0e-03
oligodendroglioma 1.300 3.5e-06
osteosarcoma 2.559 3.9e-03
ovarian cancer 1.400 3.0e-03
pituitary cancer 1.100 2.3e-04
primitive neuroectodermal tumor 2.000 2.0e-02
psoriasis -1.500 3.0e-07
subependymal giant cell astrocytoma 1.432 1.5e-02

Protein-protein Interaction (11)

Gene RIF (1253)

AA Sequence

MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEE      1 - 70
QKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQM     71 - 140
ELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVA    141 - 210
AVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEE    211 - 280
VDLACTPTDVRDVDI                                                           281 - 295
//

Text Mined References (1287)

PMID Year Title