Property Summary

NCBI Gene PubMed Count 43
PubMed Score 123.72
PubTator Score 57.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count Z-score Confidence
Cancer 2346 3.089 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
juvenile dermatomyositis 1.199 7.6e-11
acute quadriplegic myopathy 1.136 9.5e-06
primary pancreatic ductal adenocarcinoma -1.042 1.5e-02
spina bifida -1.402 4.1e-02
ovarian cancer -1.200 2.9e-03

Gene RIF (15)

PMID Text
26042770 our results suggest that mTORC1 activation in NAFLD and insulin resistance results in down-regulation of the CDK8-CycC complex and elevation of lipogenic protein expression.
25986860 results suggest that CCNC temporarily protects SRC-2 against degradation and this event is involved in the transcriptional regulation of SRC-2 cell cycle target genes.
25344755 cyclin-C-CDK complexes phosphorylate the Notch1 intracellular domain (ICN1) and promote ICN1 degradation
24754906 Cancer-mediated CDK8 point mutations (D173A and D189N) change the binding pattern of cdk8 to its partner, CycC.
23630251 analysis of the structure-kinetic relationship of the cyclin-dependent kinase 8 (CDK8)/cyclin C (CycC) complex
22024040 Silencing beta-catenin gene may induce changes of cell cycle and in cyclin B1 and cyclin C protein expression.
21806996 2.2-A crystal structure of CDK8/CycC in complex with sorafenib; CDK8 structure reveals a unique CycC recognition helix that explains the specificity of the CDK8/CycC pair and discrimination among the highly promiscuous binding in the CDK/cyclin family
19967789 Studies establish cyclin C as a critical regulator of the G(0)/G(1) transition of human HSPCs and suggest that modulating cyclin C levels may be useful for HSC expansion and more efficient engraftment.
19683536 Data suggests that the primary regulation of Cyclin C by all-trans RA and Forskolin mediates some of the cell cycle control actions of these compounds.
17385550 C2 isoform may play a presently unexplored and important role in mammalian testis and probably this isoform is the one that is mainly implicated in cell cycle regulation.
17089020 Physical chromosome mapping of the deleted region of chromosome 6 suggests that CCNC is a candidate tumor suppressor gene.
15863722 Identification of multiple 1alpha,25(OH)2D3 response elements in the cyclin C promoter.
15084261 A cellular pool of cyclin C combines with cdk3 to stimulate pRb phosphorylation at S807/811 during the G0/G1 transition, and this phosphorylation is required for cells to exit G0 efficiently.
12600719 The present observations suggest different cellular functions of cyclin C in neurons and astrocytes in alzheimer's disease.
9121429 HIV-1 Tat interacts with the RNA polymerase II holoenzyme, which includes cyclin c, during Tat-mediated transactivation of the HIV-1 LTR

AA Sequence

MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFK      1 - 70
RFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEF     71 - 140
YLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQ    141 - 210
KDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSY    211 - 280
SQS                                                                       281 - 283
//

Text Mined References (48)

PMID Year Title
26042770 2015 mTORC1 Down-Regulates Cyclin-Dependent Kinase 8 (CDK8) and Cyclin C (CycC).
25986860 2015 Cyclin C interacts with steroid receptor coactivator 2 and upregulates cell cycle genes in MCF-7 cells.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25344755 2014 Cyclin C is a haploinsufficient tumour suppressor.
24754906 2014 All-atomic molecular dynamic studies of human CDK8: insight into the A-loop, point mutations and binding with its partner CycC.
23746844 2013 HIF1A employs CDK8-mediator to stimulate RNAPII elongation in response to hypoxia.
23630251 2013 Structure-kinetic relationship study of CDK8/CycC specific compounds.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
22024040 The effect of cell cycle and expression of cyclin B1 and cyclin C protein in hepatocellular carcinoma cell line HepG2 and SMMC-7721 after of silencing ?-catenin gene.
21806996 2011 The structure of CDK8/CycC implicates specificity in the CDK/cyclin family and reveals interaction with a deep pocket binder.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19967789 2010 Cyclin C regulates human hematopoietic stem/progenitor cell quiescence.
19914168 2009 Nuclear CDKs drive Smad transcriptional activation and turnover in BMP and TGF-beta pathways.
19683536 2009 Cell cycle regulatory effects of retinoic Acid and forskolin are mediated by the cyclin C gene.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19047373 2009 The human CDK8 subcomplex is a histone kinase that requires Med12 for activity and can function independently of mediator.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17385550 2007 Two isoforms of the human cyclin C gene are expressed differentially suggesting that they may have distinct functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17089020 2006 Highly frequent allelic loss of chromosome 6q16-23 in osteosarcoma: involvement of cyclin C in osteosarcoma.
16595664 2006 Human Mediator enhances basal transcription by facilitating recruitment of transcription factor IIB during preinitiation complex assembly.
16341674 2005 Transcriptome analysis of human gastric cancer.
15863722 2005 Regulation of the human cyclin C gene via multiple vitamin D3-responsive regions in its promoter.
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
15084261 2004 Cyclin C/cdk3 promotes Rb-dependent G0 exit.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12600719 Cyclin C expression is involved in the pathogenesis of Alzheimer's disease.
12584197 2003 Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11416138 2001 Characterization of mediator complexes from HeLa cell nuclear extract.
10993082 2000 TFIIH is negatively regulated by cdk8-containing mediator complexes.
10235266 1999 Ligand-dependent transcription activation by nuclear receptors requires the DRIP complex.
10198638 1999 Identity between TRAP and SMCC complexes indicates novel pathways for the function of nuclear receptors and diverse mammalian activators.
10024883 1999 A novel human SRB/MED-containing cofactor complex, SMCC, involved in transcription regulation.
9734358 1998 NAT, a human complex containing Srb polypeptides that functions as a negative regulator of activated transcription.
9710619 1998 A human RNA polymerase II complex containing factors that modify chromatin structure.
9443979 1998 Factors associated with the mammalian RNA polymerase II holoenzyme.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
8833152 1996 Molecular cloning and chromosomal localization of the human cyclin C (CCNC) and cyclin E (CCNE) genes: deletion of the CCNC gene in human tumors.
8700522 1996 Cyclin C/CDK8 is a novel CTD kinase associated with RNA polymerase II.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7738192 1995 Disappearance of cyclin A correlates with permanent withdrawal of cardiomyocytes from the cell cycle in human and rat hearts.
7698009 1995 Chromosomal mapping of the genes for the human cell cycle proteins cyclin C (CCNC), cyclin E (CCNE), p21 (CDKN1) and KAP (CDKN3).
7568034 1995 Identification of human cyclin-dependent kinase 8, a putative protein kinase partner for cyclin C.
1833066 1991 Isolation of three novel human cyclins by rescue of G1 cyclin (Cln) function in yeast.
1260071 1976 Magnetic circular dichroism on the reversible oxygenation of dimethylmesoporphyrin-IX-atopyridinecobalt (II).