Property Summary

NCBI Gene PubMed Count 48
PubMed Score 82.64
PubTator Score 41.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.075 2.2e-02
malignant mesothelioma 1.200 1.9e-06
psoriasis 1.800 2.2e-45
glioblastoma 3.500 2.6e-06
posterior fossa group A ependymoma 2.400 4.1e-07
sonic hedgehog group medulloblastoma 4.600 1.4e-12
atypical teratoid / rhabdoid tumor 3.500 2.2e-12
medulloblastoma, large-cell 4.300 1.5e-07
primitive neuroectodermal tumor 4.100 2.6e-07
Atopic dermatitis 1.500 2.9e-04
adrenocortical carcinoma 3.442 1.2e-06
tuberculosis 1.100 3.9e-03
non-small cell lung cancer 3.797 6.7e-35
intraductal papillary-mucinous carcinoma... 2.700 2.6e-05
intraductal papillary-mucinous neoplasm ... 3.200 2.2e-04
lung cancer 2.300 9.0e-04
pancreatic cancer 1.300 2.6e-05
breast carcinoma 2.100 2.7e-06
interstitial cystitis 1.500 2.8e-02
lung adenocarcinoma 2.100 3.2e-08
pediatric high grade glioma 3.200 3.7e-08
nasopharyngeal carcinoma 1.100 8.6e-04
Endometriosis 1.586 1.2e-02
Breast cancer 2.800 1.1e-19
ductal carcinoma in situ 2.400 1.2e-03
invasive ductal carcinoma 3.100 6.0e-05
ovarian cancer 2.200 1.3e-06

Gene RIF (25)

PMID Text
26349989 overexpression of CCNB2 protein is associated with clinical progression and poor prognosis in non-small cell lung cancer
24375198 there was no significance in the 5-year overall survival rates among the patients with squamous cell carcinoma between expressing lower and higher level of cyclin B2 mRNA
24324638 Cyclin B1 and cyclin B2 are interchangeable for ability to promote G2 and M transition in HeLa cells.
23282137 Suggest that cytoplasmic CCNB2 may function as an oncogene and could serve as a potential biomarker of unfavorable prognosis over short-term follow-up in breast cancer.
21161946 The relative expression level of circulating CCNB2 mRNA in cancer patients was significantly higher than that in normal controls and benign diseases group. Circulating CCNB2 mRNA level significantly correlated with cancer stage and metastasis status.
20660152 Data suggest that cyclin A2 helps initiate mitosis, in part through its effects on cyclin B1, and that cyclins B1 and B2 are particularly critical for the maintenance of the mitotic state.
19738611 Observational study of gene-disease association. (HuGE Navigator)
19664331 The radiosensitizing effect of paclitaxel on KB cells may be due to the down-regulated expression of PRC1 and cyclin B2.
19223528 an increased CCNB2 expression in human pituitary adenomas of different histotypes that is directly correlated with HMGA1 and HMGA2 expression.
18692784 The CCNA1, CCNB1, CCNB2, PRM1, and PRM2 messenger RNA transcript ratios were significantly decreased in patients with spermatogenic disorders. Transcript ratios in patients with successful sperm retrieval were higher than with failed sperm retrieval.
17549666 This gene may be used as a very reliable biomarker of lung adenocarcinoma.
17533373 severe reduction by separate RNA interference of either cyclin B1 or cyclin B2 protein levels results in little or no alteration of the cell cycle and, more specifically, of mitosis progression
17289878 cyclin B2 expression in colorectal adenocarcinoma is dependent on NF-Y
12482752 p300 binds to multiple NF-Y trimers to regulate cyclin B2 promoter function
11960377 Overexpression of B-type cyclins alters chromosomal segregation
11878934 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
11531413 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
10958988 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
9560267 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
9520381 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
9094673 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
7666531 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
7494303 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
7474100 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest
7474080 The human Vpr interacting protein (hVIP/MOV34) is a likely cellular cofactor for HIV-1 Vpr inactivation of the cdc2-cyclin B kinase complex and induction of cell cycle arrest

AA Sequence

MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNK      1 - 70
QLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQ     71 - 140
YLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQL    141 - 210
VGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVD    211 - 280
VEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKN    281 - 350
VVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS                          351 - 398
//

Text Mined References (55)

PMID Year Title
26349989 2015 CCNB2 overexpression is a poor prognostic biomarker in Chinese NSCLC patients.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24375198 2014 Strong expression of cyclin B2 mRNA correlates with a poor prognosis in patients with non-small cell lung cancer.
24324638 2013 The kinetics of G2 and M transitions regulated by B cyclins.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23282137 2013 Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
21161946 Use of serum circulating CCNB2 in cancer surveillance.
20660152 2010 The roles of cyclin A2, B1, and B2 in early and late mitotic events.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19664331 2009 [Molecular mechanism of radiosensitizing effect of paclitaxel].
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19223528 2009 HMGA proteins up-regulate CCNB2 gene in mouse and human pituitary adenomas.
18692784 2009 Cyclin and protamine as prognostic molecular marker for testicular sperm extraction in patients with azoospermia.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17549666 Usefulness of CDK5RAP3, CCNB2, and RAGE genes for the diagnosis of lung adenocarcinoma.
17533373 2007 Cyclin B2 suppresses mitotic failure and DNA re-replication in human somatic cells knocked down for both cyclins B1 and B2.
17408621 2007 Cyclin B1/Cdk1 binds and phosphorylates Filamin A and regulates its ability to cross-link actin.
17388661 2007 Exquisite sensitivity of TP53 mutant and basal breast cancers to a dose-dense epirubicin-cyclophosphamide regimen.
17289878 2007 NF-Y-dependent cyclin B2 expression in colorectal adenocarcinoma.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15232106 2004 Self-assembling protein microarrays.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12727876 2003 Cdc2-mediated phosphorylation of Kid controls its distribution to spindle and chromosomes.
12482752 2003 Interactions between p300 and multiple NF-Y trimers govern cyclin B2 promoter function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11960377 2002 Overexpression of B-type cyclins alters chromosomal segregation.
11878934 2002 Hypophosphorylation of poly(A) polymerase and increased polyadenylation activity are associated with human immunodeficiency virus type 1 Vpr expression.
11531413 2001 HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10958988 2000 Cell cycle G2 arrest induced by HIV-1 Vpr in fission yeast (Schizosaccharomyces pombe) is independent of cell death and early genes in the DNA damage checkpoint.
9926943 1999 Functional association of TGF-beta receptor II with cyclin B.
9560267 1998 HIV transcriptional activation by the accessory protein, VPR, is mediated by the p300 co-activator.
9539739 1998 Cyclin B2-null mice develop normally and are fertile whereas cyclin B1-null mice die in utero.
9520381 1998 HIV-1 Vpr interacts with a human 34-kDa mov34 homologue, a cellular factor linked to the G2/M phase transition of the mammalian cell cycle.
9094673 1997 Human immunodeficiency virus type 1 vpr gene induces phenotypic effects similar to those of the DNA alkylating agent, nitrogen mustard.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8070405 1994 The differential localization of human cyclins A and B is due to a cytoplasmic retention signal in cyclin B.
7737117 1995 Human cyclins B1 and B2 are localized to strikingly different structures: B1 to microtubules, B2 primarily to the Golgi apparatus.
7666531 1995 The human immunodeficiency virus type 1 vpr gene arrests infected T cells in the G2 + M phase of the cell cycle.
7494303 1995 Mutational analysis of cell cycle arrest, nuclear localization and virion packaging of human immunodeficiency virus type 1 Vpr.
7474100 1995 Human immunodeficiency virus type 1 Vpr arrests the cell cycle in G2 by inhibiting the activation of p34cdc2-cyclin B.
7474080 1995 Human immunodeficiency virus type 1 viral protein R (Vpr) arrests cells in the G2 phase of the cell cycle by inhibiting p34cdc2 activity.
1717476 1991 Human cyclins A and B1 are differentially located in the cell and undergo cell cycle-dependent nuclear transport.