Property Summary

NCBI Gene PubMed Count 51
PubMed Score 85.11
PubTator Score 41.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 3.442 1.2e-06
adult high grade glioma 2.700 9.1e-06
Atopic dermatitis 1.500 2.9e-04
atypical teratoid / rhabdoid tumor 3.500 2.2e-12
Breast cancer 2.800 1.1e-19
breast carcinoma 2.100 2.7e-06
ductal carcinoma in situ 2.400 1.2e-03
Endometriosis 1.586 1.2e-02
ependymoma 1.900 9.8e-07
glioblastoma 3.200 3.9e-11
group 3 medulloblastoma 4.500 1.1e-09
interstitial cystitis 1.500 2.8e-02
intraductal papillary-mucinous carcinoma... 2.700 2.6e-05
intraductal papillary-mucinous neoplasm ... 3.200 2.2e-04
invasive ductal carcinoma 3.100 6.0e-05
lung adenocarcinoma 1.100 2.5e-07
lung cancer 2.300 9.0e-04
malignant mesothelioma 1.200 1.9e-06
medulloblastoma, large-cell 4.300 1.5e-07
nasopharyngeal carcinoma 1.100 8.6e-04
non-small cell lung cancer 3.797 6.7e-35
ovarian cancer 2.200 1.3e-06
pancreatic cancer 1.300 2.6e-05
primitive neuroectodermal tumor 4.100 2.6e-07
psoriasis 1.300 5.8e-06
tuberculosis 1.100 3.9e-03
Waldenstrons macroglobulinemia 1.075 2.2e-02

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNK      1 - 70
QLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQ     71 - 140
YLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQL    141 - 210
VGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVD    211 - 280
VEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKN    281 - 350
VVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS                          351 - 398
//

Text Mined References (58)

PMID Year Title