Property Summary

NCBI Gene PubMed Count 32
PubMed Score 361.74
PubTator Score 41.27

Knowledge Summary

Patent

No data available

Gene RIF (12)

PMID Text
25449536 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies
24727646 PCR results show that lower copy numbers of CCL4L2 are observed in the Caucasian population nd higher copy numbers are observed in the Black population of South Africa.
21614014 CCL4L1 allele frequency is higher in severe psoriasis, whereas CCL4L2 is more frequent in patients with a milder disease.
20659124 Studies indicate that complete phenotypic impact requires dissecting the combinatorial genomic complexity posed by various proportions of distinct CCL3L and CCL4L genes among individuals.
19898927 higher level of expression at systemic level is associated with protection from HIV-1 infection in women from Benin
19279442 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19148142 A combined analysis of CCL4L copy number variation and the rs4796195 CCL4L single nucleotide polymorphism demonstrated that the effect of CCL4L copy number in acute rejection is mainly because of the number of copies of the CCL4L1 allelic variant.
19148142 Observational study of gene-disease association. (HuGE Navigator)
18464913 Observational study of gene-disease association. (HuGE Navigator)
18368065 Observational study of gene-disease association. (HuGE Navigator)
17330138 Observational study of gene-disease association. (HuGE Navigator)
17330138 Neither CCL3L1 nor CCL4L1 gene copy number variation showed appreciable impact on susceptibility to or control of HIV-1 infection.

AA Sequence

MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRG      1 - 70
KQVCADPSESWVQEYVYDLELN                                                     71 - 92
//

Text Mined References (33)

PMID Year Title
25449536 2015 Genes associated with antibody-dependent cell activation are overexpressed in renal biopsies from patients with antibody-mediated rejection.
24727646 2014 Comparison of a quantitative Real-Time PCR assay and droplet digital PCR for copy number analysis of the CCL4L genes.
21614014 2011 CCL4L polymorphisms and CCL4/CCL4L serum levels are associated with psoriasis severity.
20659124 2010 Copy number variation in chemokine superfamily: the complex scene of CCL3L-CCL4L genes in health and disease.
19898927 2010 Chemokine expression patterns in the systemic and genital tract compartments are associated with HIV-1 infection in women from Benin.
19279442 2009 Combinatorial content of CCL3L and CCL4L gene copy numbers influence HIV-AIDS susceptibility in Ukrainian children.
19148142 2009 Copy number variation in the CCL4L gene is associated with susceptibility to acute rejection in lung transplantation.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18368065 2008 Population structure in copy number variation and SNPs in the CCL4L chemokine gene.
17330138 2007 CCL3L1 and CCL4L1: variable gene copy number in adolescents with and without human immunodeficiency virus type 1 (HIV-1) infection.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15843566 2005 Multiple products derived from two CCL4 loci: high incidence of a new polymorphism in HIV+ patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15240137 2004 Functional redundancy of the human CCL4 and CCL4L1 chemokine genes.
15028295 2004 CCL3L1 and CCL4L1 chemokine genes are located in a segmental duplication at chromosome 17q12.
14673550 2004 Independent expression of the two paralogous CCL4 genes in monocytes and B lymphocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401480 2002 Macrophage inflammatory protein-1.
12355456 2002 Gene copy number regulates the production of the human chemokine CCL3-L1.
12070155 2002 Natural truncation of the chemokine MIP-1 beta /CCL4 affects receptor specificity but not anti-HIV-1 activity.
11685466 2001 The human MIP-1beta chemokine is encoded by two paralogous genes, ACT-2 and LAG-1.
10540332 1999 The assignment of chemokine-chemokine receptor pairs: TARC and MIP-1 beta are not ligands for human CC-chemokine receptor 8.
9521068 1998 Identification of the CC chemokines TARC and macrophage inflammatory protein-1 beta as novel functional ligands for the CCR8 receptor.
8661057 1996 A YAC contig of the human CC chemokine genes clustered on chromosome 17q11.2.
8525373 1995 Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells.
8134838 1994 High-resolution solution structure of the beta chemokine hMIP-1 beta by multidimensional NMR.
2809212 1989 A novel polypeptide secreted by activated human T lymphocytes.
2568930 1989 Isolation and characterization of a cDNA encoding a putative cytokine which is induced by stimulation via the CD2 structure on human T lymphocytes.
2521882 1989 Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors.
2521353 1989 A family of small inducible proteins secreted by leukocytes are members of a new superfamily that includes leukocyte and fibroblast-derived inflammatory agents, growth factors, and indicators of various activation processes.
2462251 1988 Identification, cloning, and characterization of an immune activation gene.
1972563 1990 Two inflammatory mediator cytokine genes are closely linked and variably amplified on chromosome 17q.
1894635 1991 The gene encoding the Act-2 cytokine. Genomic structure, HTLV-I/Tax responsiveness of 5' upstream sequences, and chromosomal localization.