Property Summary

NCBI Gene PubMed Count 139
PubMed Score 903.53
PubTator Score 1228.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Synonym

Accession P13236 P22617 Q13704 Q3SXL8 Q6FGI8
Symbols ACT2
G-26
HC21
LAG1
LAG-1
MIP1B
SCYA2
SCYA4
MIP1B1
AT744.1
MIP-1-beta

Gene

PDB

4RAL   1HUM   1HUN   1JE4   2FFK   2FIN   2X6L   3TN2  

  Ortholog (1)

Species Source Disease
Rat OMA Inparanoid

Protein-protein Interaction (3)

Gene RIF (148)

PMID Text
26874795 High serum IL-12 levels associated with increased densities of peritumoral CD8(+) T cells, intraepithelial CD3(+) T cells and intratumoral neutrophils, while high serum CCL4 levels associated with increased densities of peritumoral CD68(+) cells
26854929 Tregs from subjects with established type 1 diabetes were impaired in their ability to produce CCL3 and CCL4.
26786659 YY1 regulates lung CCL4 transcription in pulmonary tuberculosis.
26786652 Report use of up-converting phosphor reporter technology in a lateral flow based test to determine CCL4 levels in pleural effusions and whole blood for tuberculosis diagnosis.
26285074 clinical samples, confirmed TB and non-TB (i.e. other respiratory diseases (ORD)) cases, were collected and analyzed simultaneously with quality control (QC) human IP-10 or CCL4 standards
26284335 CCL4 and CCL20 recruit functionally different T lymphocyte subsets into oesophageal carcinoma.
26270232 High serum levels of inflammatory chemokines such as CCL4 and CCL5 in the serum of cirrhotic patients indicate the presence of hepatocellular carcinoma.
26158606 IL8, IL-1Ra, MCP-1, and MIP-1beta are significantly lower in patients with type 1 diabetes than controls.
26115437 Elevated pre-treatment levels of CCL4 identified long-term immunological nonresponse patients who started treatment at CD4 counts<200.
26074318 MIP-1beta, TNF-alpha and fractalkine are expressed in plasma, which reflects the levels of several pro-atherogenic cytokines in plaque tissue
25889297 CXCL13 and CCL4 could act as circulating biomarkers in autoimmune hemolytic anemia (AIHA), and higher plasma soluble TNFRII might favor the diagnosis of SLE-related instead of primary AIHA.
25809376 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
25760046 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
25744730 we found that Brachyury expression was inversely correlated with CCL2 and CCL4 expression in human lung tumors
25620312 Findings demonstrated that miR-125b is a negative regulator of CCL4 and its reduction is partially responsible for the age-related increase of CCL4.
25548252 the secretion of IL-1alpha, IL-1beta, IL-12b, and CCL4 occurs during gelatinase degranulation, a process controlled by STX3.
25529283 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
25449536 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies
25240755 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
25063291 Studied expression level of MIP-1alpha, MIP-1beta and MCP-1 in psoriasis vulgaris, and explored their roles in the pathogenesis of psoriasis vulgaris.
25008917 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
25004830 suggest possible role of CD8+ cells and CD4+ cells in recruiting T cells to the site of inflammation in sarcoidosis through the release of CCL4.
24942586 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
24899193 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
24797975 MIP-1beta in the ascitic fluid was significantly higher in patients with spontaneous bacterial peritonitis.
24500432 Report CCL4 expression following resistance exercise.
24489105 BRAF inhibition causes decreased CXCL8 secretion from melanoma cells and induce an immune response against the tumor associated with increased IFN-gamma, CCL4, and TNF-alpha.
24370436 Transcription of CCL3 and CCL4 by THP-1 monocytic cells up-regulated in the presence of 27-Hydroxycholesterol and 7alpha-hydroxycholesterol.
24227857 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
24116893 the role of Tax2-mediated activation of the nuclear factor kappa B (NF-kappaB) signalling pathway on the production of the anti-viral CC-chemokines MIP-1alpha, MIP-1beta and RANTES.
23998687 The allele and genotype frequencies of CCL2, CCL3 and CCL4 were not different between HCs and patients with PTB.
23996681 CCL2 genetic polymorphism is associated with drug-resistant epilepsy in Chinese paediatric patients
23898208 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
23760235 Epstein-Barr virus latent membrane protein 1 (LMP1)-mediated Jun N-terminal protein kinase activation was responsible for upregulation of CCL3 and CCL4 in B cells.
23692808 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
23554973 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
23509148 These findings indicate that dipterinyl calcium pentahydrate (DCP) induced mycobacterial killing via MIP-1beta- and nitric oxide-dependent effects.
23383108 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
23152559 Tumor-infiltrating monocytic myeloid-derived suppressor cells produce high levels of transgenic CCR5 ligands CCL3, CCL4, and CCL5 and directly attract regulatory T cells (Tregs) in a CCR5-dependent manner.
22407921 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
22156348 IL-27 priming results in enhanced lipopolysaccharide (LPS)-induced MIP-1beta expression in human primary monocytes
22085486 Data indicate that IFN2b treatment upregulates the expression of CCR5, RANTES, MIP-1alpha and MIP-1beta on monocytes/macrophages.
21978000 Data show that HLA-B*5701+LTNP displayed a higher expansion ability of Gag and Nef-specific MIP(+) TNF(-) IL-2(+) T cells than HLA-B*5701-LTNP.
21914058 study of the involvement of host factors in the rapid progression to fulminant hepatic failure during an outbreak of hepatitis B; NKT cells and CCL4 might be playing a pivotal role in limiting HBV infection among the patients investigated
21890375 The effect of adiponectin on CCL2, -3, -4, and -5 and their corresponding receptors CCR1, CCR2, and CCR5 has been analyzed.
21464938 LPA5 is a bona fide LPA receptor on human mast cells responsible for the majority of LPA induced MIP-1beta release.
21264298 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
21082024 Data show that the ex vivo NKT cell response is predominantly comprised of the chemokines MIP1-alpha, and MIP1-beta as well as the Th1 cytokines IFN-gamma and TNF-alpha.
21030011 In CD8+ T-lymphocyte transwell culture, MIP-1beta and MIP-1alpha strongly correlate with the magnitude of soluble noncytolytic suppression of CXCR4-tropic virus.
20959807 Crystal structures reveal that MIP-1 aggregation is a polymerization process and human MIP-1-alpha and MIP-1-beta form rod-shaped, double-helical polymers.
20952681 ET-1-mediated MIP-1beta gene expression is regulated via hypoxia-response elements, AP-1, and NF-kappaB cis-binding elements in its promoter and negatively regulated by microRNA-195, which targets the 3' untranslated region of MIP-1beta RNA
20855878 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
20817073 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
20702408 CCAAT/Enhancer-binding protein {beta} and NF-{kappa}B mediate high level expression of chemokine genes CCL3 and CCL4 by human chondrocytes in response to IL-1{beta}.
20598119 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
20575639 eleveted tear levels in cystic fibrosis patients
20504918 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
20503287 Observational study of gene-disease association. (HuGE Navigator)
20482449 Data show that pre-CPB, plasma levels of EGF and MIP-1beta, 2 h following CPB, sVCAM-1, fractalkine and MIP-1ALPHA, and at later time points, sVCAM-1 and IL-6 were associated with AKI.
20403075 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
20380698 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
20200978 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19917679 CCL3, CCL4, and CCL5 did not induce chemotaxis, but at relatively high concentrations they transiently enhanced CXCL12-mediated chemotaxis of CD34(+) cord blood cells.
19846870 chronic hepatitis C virus infection is associated with an expansion of CD56(-) NK cells functionally skewed toward MIP-1beta production only
19841187 Late memory CD8(+) T cells produced abundant amounts of CC chemokines (MIP-1beta, MIP-1alpha, and RANTES) but not IL-2.
19620252 An arrestin-dependent multi-kinase signaling complex mediates MIP-1beta/CCL4 signaling and chemotaxis of primary human macrophages.
19565503 There is a unique role of osteopontin in leukocyte migration, in the context of perpetuation of rheumatoid synovitis through the induction of MCP-1 and MIP-1beta.
19358850 ELISpot analysis of LPS-stimulated leukocytes: human granulocytes selectively secrete IL-8, MIP-1beta and TNF-alpha.
19328808 Serum MIP-1beta level might be a useful predictor for cerebro-cardiovascular events in hypertensive patients.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19234184 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
19103522 observed that CCL4, CXCL1 and CXCL8 secretion, following PROK1 induction
19074730 A novel mechanism of cross talk between chronic lymphocytic leukemia cells and their microenvironment, namely, the secretion of 2 T-cell chemokines in response to nurselike cells coculture and BCR stimulation.
19057841 Data suggest that increased MIP-1alpha/beta production enhances multiple myeloma cell binding to stromal cells by VLA-4-VCAM-1 adhesion, forming a "vicious cycle" between MM cell adhesion to stromal cells and MIP-1 production via VLA-4-VCAM-1 interaction.
19047106 CX3CL1, IL-15, and CCL4 can serve as independent predictors of biochemical recurrence.
18802359 CysLTs induce MIP-1alpha and MIP-1beta production mediated by ERK via binding to the CysLT(1) receptor in human monocytes/macrophages.
18623207 MCP-1, MIP-1beta, and IL-8 play important roles in the pathophysiology of Hemophagocytic lymphohistiocytosis (HLH). In addition, the serum concentrations of these chemokines may be sensitive markers for assessing disease activity in patients with HLH.
18368065 Population structure in copy number variation and SNPs in the CCL4 chemokine gene are reported.
18346864 Data show that MIP-1 alpha and MIP-1 beta bind to the HIV co-receptor CCR5 and blok HIV entry into CD4(+) lymphocytes.
18203956 PC-PLC activation through CCR5 is specifically induced by gp120, since triggering CCR5 through its natural ligand CCL4 (MIP-1beta) does not affect PC-PLC cellular distribution and enzymatic activity, as well as CCL2 secretion
18076643 The strong upregulation of CCL3 and CCL4 implicates these chemokines in the etiology and pathogenesis of TLE.
17765942 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
17703412 Observational study of gene-disease association. (HuGE Navigator)
17644519 the CC chemokine MIP-1beta dimer is not able to bind or activate its receptor and implicates the CC chemokine monomer as the sole receptor-interacting unit
17431094 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
17330138 Observational study of gene-disease association. (HuGE Navigator)
17005260 findings show that CCL3, CCL4 and CCL5 bind on the Leishmania promastigotes
16963564 Results describe the structure of an orthopoxvirus vCCI in complex with a human CC chemokine, MIP-1beta (macrophage inflammatory protein 1beta).
16841089 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
16773571 variation in the CCL18-CCL3-CCL4 chemokine gene cluster influences HIV Type 1 transmission and AIDS disease progression
16697675 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
16393999 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
16379602 Higher amounts of MIP-1alpha, MIP-1beta, and RANTES were detected in plasma of HIV-1-positive individuals, particularly those with concomitant pulmonary tuberculosis, although the increase was not found to be statistically significant.
16354571 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
16160188 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
15897346 upregulation of MIP-1beta and downregulation of VE-cadherin may strongly participate in human acute heart rejection.
15831560 Normal human vaginal epithelial cells constitutively secrete the chemokine macrophage inflammatory protein CCL20, known to recruit Langerhans cell precursors selectively via its cognate CC chemokine receptor CCR6.
15817944 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
15780175 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
15645140 RANTES, MIP-1beta and IL-18 are expressed in LGL leukemia
15638726 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
15588341 produced by neonatal natural killer cells and contributes to suppession of HIV replication
15585099 lymphocytes of HIV patients display a disrupted capacity to secrete the beta-chemokines MIP-1 alpha and MIP-1 beta, which may constitute a mechanism of immune dysfunction in progressive HIV infection
15529362 MCP-1, MIP-1beta, and IL-8 elevated in relapsing polychondritis(RP) are proinflammatory chemokines, characteristic of activation of monocytes and macrophages and, in the case of IL-8, also of neutrophils. Role for cell-mediated immune response in RP.
15481145 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
15142381 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
14761932 Activated T cells from GRK2+/- mice, which have a 50% reduction in GRK2 protein levels, showed a significant 40% increase in chemotaxis toward the CCR5 ligand CCL4
14746807 Results suggest that interleukin-1beta-mediated up-regulation of macrophage inflammatory protein-1beta production in hepatic cells may contribute to continuous recruitment of inflammatory cells to the liver and maintenance of inflammation.
14673550 Monocytes and B cells utilize different mechanisms to regulate expression of the 2 CCL4 genes (ACT-2 and LAG-1) & suggest that the 2 genes may not have identical activities.
14582706 MIP-1beta may be related to the scattering and invasion step of gastric carcinoma cells with undifferentiated phenotype
12679478 results suggest that endometrial macrophage inflammatory protein-1beta may be involved in the recruitment of NK cells from circulating peripheral blood
12651610 Cathepsin D specifically cleaves this protein that is expressed in human breast cancer.
12603824 IL-1beta-induced MIP-1alpha and -1beta expression in NT2-N cells
12574335 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
12411442 binding surface and affinity of monomeric and dimeric forms for various glycosaminoglycan disaccharides
12401480 MIP-1alpha and MIP-1beta show diverging signaling capacities [review]
12393716 Lymphotactin, (MIP)-1alpha, and MIP-1beta chemokines were all rapidly induced by engagement of CD28 and were calcineurin sensitive.
12393595 After stimulation via high-affinity FcepsilonRI, the transcriptional levels of I-309 (CCL1), MIP-1alpha (CCL3) and MIP-1beta (CCL4) were found among the 10 most increased human and mouse transcripts from approximately 12 000 genes
12377943 role of IL-12 and IFN-gamma on inducing inflammatory chemokine (MIP-1beta) secretion and down-regulating CCR5 expression in human T cells
12370346 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
12218153 Expression of MIP-1 beta is induced by stimulation of monocytic cells through Fc gamma receptors and involves activation of CCAAT/enhancer-binding protein beta sites.
12200385 role in the development of osteolytic lesions in multiple myeloma
12089333 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
12070155 results demonstrate that NH(2)-terminally truncated MIP-1 beta functions as a chemokine agonist with expanded receptor reactivity; may represent an important mechanism for regulation of immune cell recruitment during inflammatory and antiviral responses
12036855 Cholesterol is essential for macrophage inflammatory protein 1 beta binding and signaling and conformational integrity of CC chemokine receptor 5.(MIP-1 beta is the entry SCYA4 or LD78? If so, please add the term to SCYA4 or LD78.)
11751963 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
11602715 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
11485305 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
11313374 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
11129109 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11023526 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
10985253 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
10938094 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
10820198 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
10751368 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
10644351 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
10470075 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
10089882 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
9658081 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
9576751 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
9520456 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
9420238 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
9359702 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
9256481 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
8906796 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
8906795 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells
8898753 ASP-YL9 peptide (89YLYNSLLQL97) induces release of IL-2, IFN-gamma, TNF-alpha, or MIP-1beta in antigen-specific CD8+ T-cells

AA Sequence

MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRS      1 - 70
KQVCADPSESWVQEYVYDLELN                                                     71 - 92
//

Text Mined References (139)

PMID Year Title
26874795 2016 The relationships between serum cytokine levels and tumor infiltrating immune cells and their clinical significance in colorectal cancer.
26854929 2016 T regulatory cell chemokine production mediates pathogenic T cell attraction and suppression.
26786659 2016 A novel role of Yin-Yang-1 in pulmonary tuberculosis through the regulation of the chemokine CCL4.
26786652 2016 Use of lateral flow assays to determine IP-10 and CCL4 levels in pleural effusions and whole blood for TB diagnosis.
26285074 2016 Multi-center evaluation of a user-friendly lateral flow assay to determine IP-10 and CCL4 levels in blood of TB and non-TB cases in Africa.
26284335 2015 CTL- vs Treg lymphocyte-attracting chemokines, CCL4 and CCL20, are strong reciprocal predictive markers for survival of patients with oesophageal squamous cell carcinoma.
26270232 2015 Serum levels of chemokines CCL4 and CCL5 in cirrhotic patients indicate the presence of hepatocellular carcinoma.
26158606 2015 Large-Scale Discovery and Validation Studies Demonstrate Significant Reductions in Circulating Levels of IL8, IL-1Ra, MCP-1, and MIP-1? in Patients With Type 1 Diabetes.
26115437 2015 High MIP-1? Levels in Plasma Predict Long-Term Immunological Nonresponse to Suppressive Antiretroviral Therapy in HIV Infection.
26074318 2015 Circulating cytokines reflect the expression of pro-inflammatory cytokines in atherosclerotic plaques.
25889297 2015 CXCL13, CCL4, and sTNFR as circulating inflammatory cytokine markers in primary and SLE-related autoimmune hemolytic anemia.
25744730 2015 T-box transcription factor Brachyury in lung cancer cells inhibits macrophage infiltration by suppressing CCL2 and CCL4 chemokines.
25620312 2015 MicroRNA-125b modulates inflammatory chemokine CCL4 expression in immune cells and its reduction causes CCL4 increase with age.
25548252 2015 An essential role of syntaxin 3 protein for granule exocytosis and secretion of IL-1?, IL-1?, IL-12b, and CCL4 from differentiated HL-60 cells.
25449536 2015 Genes associated with antibody-dependent cell activation are overexpressed in renal biopsies from patients with antibody-mediated rejection.
25416956 2014 A proteome-scale map of the human interactome network.
25063291 2014 Effect of pharmacological intervention on MIP-1?, MIP-1? and MCP-1 expression in patients with psoriasis vulgaris.
25004830 Increased expression of CCL4/MIP-1? in CD8+ cells and CD4+ cells in sarcoidosis.
24797975 2014 Procalcitonin and macrophage inflammatory protein-1 beta (MIP-1?) in serum and peritoneal fluid of patients with decompensated cirrhosis and spontaneous bacterial peritonitis.
24500432 2014 Effects of ?-hydroxy-?-methylbutyrate free acid and cold water immersion on expression of CR3 and MIP-1? following resistance exercise.
24489105 2014 Dynamics of chemokine, cytokine, and growth factor serum levels in BRAF-mutant melanoma patients during BRAF inhibitor treatment.
24370436 2014 27-Hydroxycholesterol and 7alpha-hydroxycholesterol trigger a sequence of events leading to migration of CCR5-expressing Th1 lymphocytes.
24116893 2014 Human T cell leukaemia virus type 2 tax protein mediates CC-chemokine expression in peripheral blood mononuclear cells via the nuclear factor kappa B canonical pathway.
23998687 2014 CCL2, CCL3 and CCL4 gene polymorphisms in pulmonary tuberculosis patients of South India.
23996681 2013 The association between CCL2 polymorphisms and drug-resistant epilepsy in Chinese children.
23760235 2013 Autocrine CCL3 and CCL4 induced by the oncoprotein LMP1 promote Epstein-Barr virus-triggered B cell proliferation.
23597562 2013 Inhibition of tumor angiogenesis and growth by a small-molecule multi-FGF receptor blocker with allosteric properties.
23509148 2013 Dipterinyl calcium pentahydrate inhibits intracellular mycobacterial growth in human monocytes via the C-C chemokine MIP-1? and nitric oxide.
23152559 2012 Tumor-infiltrating monocytic myeloid-derived suppressor cells mediate CCR5-dependent recruitment of regulatory T cells favoring tumor growth.
22156348 2012 IL-27 enhances LPS-induced proinflammatory cytokine production via upregulation of TLR4 expression and signaling in human monocytes.
22085486 2012 Dysregulated CC receptor/ligand in monocytes/macrophages from tongue squamous cell carcinoma patients is partially rectified by interferon ?-2b.
21978000 2011 The expansion ability but not the quality of HIV-specific CD8(+) T cells is associated with protective human leucocyte antigen class I alleles in long-term non-progressors.
21914058 2011 Epidemic of hepatitis B with high mortality in India: association of fulminant disease with lack of CCL4 and natural killer T cells.
21890375 2011 Adiponectin stimulates release of CCL2, -3, -4 and -5 while the surface abundance of CCR2 and -5 is simultaneously reduced in primary human monocytes.
21464938 2011 LPA5 is abundantly expressed by human mast cells and important for lysophosphatidic acid induced MIP-1? release.
21082024 2010 A comprehensive ex vivo functional analysis of human NKT cells reveals production of MIP1-? and MIP1-?, a lack of IL-17, and a Th1-bias in males.
21030011 2011 Secretion of MIP-1? and MIP-1? by CD8(+) T-lymphocytes correlates with HIV-1 inhibition independent of coreceptor usage.
20959807 2010 Polymerization of MIP-1 chemokine (CCL3 and CCL4) and clearance of MIP-1 by insulin-degrading enzyme.
20952681 2010 Endothelin-1-induced macrophage inflammatory protein-1beta expression in monocytic cells involves hypoxia-inducible factor-1alpha and AP-1 and is negatively regulated by microRNA-195.
20702408 2010 CCAAT/enhancer-binding protein ? and NF-?B mediate high level expression of chemokine genes CCL3 and CCL4 by human chondrocytes in response to IL-1?.
20575639 2010 CCL4/MIP-1beta levels in tear fluid and serum of patients with cystic fibrosis.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20482449 2010 Exploration of disease mechanism in acute kidney injury using a multiplex bead array assay: a nested case-control pilot study.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19917679 2009 CCR5 ligands modulate CXCL12-induced chemotaxis, adhesion, and Akt phosphorylation of human cord blood CD34+ cells.
19846870 2009 Expansion of functionally skewed CD56-negative NK cells in chronic hepatitis C virus infection: correlation with outcome of pegylated IFN-alpha and ribavirin treatment.
19841187 2009 Human late memory CD8+ T cells have a distinct cytokine signature characterized by CC chemokine production without IL-2 production.
19620252 2009 An arrestin-dependent multi-kinase signaling complex mediates MIP-1beta/CCL4 signaling and chemotaxis of primary human macrophages.
19565503 2009 Role of osteopontin in induction of monocyte chemoattractant protein 1 and macrophage inflammatory protein 1beta through the NF-kappaB and MAPK pathways in rheumatoid arthritis.
19358850 2009 ELISpot analysis of LPS-stimulated leukocytes: human granulocytes selectively secrete IL-8, MIP-1beta and TNF-alpha.
19328808 2009 Macrophage inflammatory protein-1beta induced cell adhesion with increased intracellular reactive oxygen species.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19103522 2008 Prokineticin 1 induces CCL4, CXCL1 and CXCL8 in human monocytes but not in macrophages and dendritic cells.
19074730 2009 High-level expression of the T-cell chemokines CCL3 and CCL4 by chronic lymphocytic leukemia B cells in nurselike cell cocultures and after BCR stimulation.
19057841 2009 Vicious cycle between myeloma cell binding to bone marrow stromal cells via VLA-4-VCAM-1 adhesion and macrophage inflammatory protein-1alpha and MIP-1beta production.
19047106 2008 Chemokine markers predict biochemical recurrence of prostate cancer following prostatectomy.
18802359 2009 Cysteinyl leukotrienes induce macrophage inflammatory protein-1 in human monocytes/macrophages.
18623207 2008 Increased serum monocyte chemoattractant protein-1, macrophage inflammatory protein-1beta, and interleukin-8 concentrations in hemophagocytic lymphohistiocytosis.
18368065 2008 Population structure in copy number variation and SNPs in the CCL4L chemokine gene.
18346864 2008 Type C coping, alexithymia, and heart rate reactivity are associated independently and differentially with specific immune mechanisms linked to HIV progression.
18203956 2008 Phosphatidylcholine-specific phospholipase C activation is required for CCR5-dependent, NF-kB-driven CCL2 secretion elicited in response to HIV-1 gp120 in human primary macrophages.
18076643 2008 Possible role of the innate immunity in temporal lobe epilepsy.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17644519 2007 The human CC chemokine MIP-1beta dimer is not competent to bind to the CCR5 receptor.
17330138 2007 CCL3L1 and CCL4L1: variable gene copy number in adolescents with and without human immunodeficiency virus type 1 (HIV-1) infection.
17005260 2006 Evidence of direct interactions between the CC-chemokines CCL3, CCL4 and CCL5 and Leishmania promastigotes.
16963564 2006 Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta.
16773571 2006 Genetic variation in the CCL18-CCL3-CCL4 chemokine gene cluster influences HIV Type 1 transmission and AIDS disease progression.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16379602 2005 Short communication: Influence of active tuberculosis on chemokine and chemokine receptor expression in HIV-infected persons.
15897346 2005 Identification and characterization of two genes (MIP-1beta, VE-CADHERIN) implicated in acute rejection in human heart transplantation: use of murine models in tandem with cDNA arrays.
15843566 2005 Multiple products derived from two CCL4 loci: high incidence of a new polymorphism in HIV+ patients.
15831560 2005 Characterization of CCL20 secretion by human epithelial vaginal cells: involvement in Langerhans cell precursor attraction.
15645140 2005 Constitutive production of proinflammatory cytokines RANTES, MIP-1beta and IL-18 characterizes LGL leukemia.
15588341 2004 Neonatal natural killer cells produce chemokines and suppress HIV replication in vitro.
15585099 2004 Disturbed secretory capacity for macrophage inflammatory protein (MIP)-1 alpha and MIP-1 beta in progressive HIV infection.
15529362 2004 Serum cytokine profiles in relapsing polychondritis suggest monocyte/macrophage activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15067078 2004 Differential recognition and scavenging of native and truncated macrophage-derived chemokine (macrophage-derived chemokine/CC chemokine ligand 22) by the D6 decoy receptor.
14761932 2004 Reduced GRK2 level in T cells potentiates chemotaxis and signaling in response to CCL4.
14746807 2003 Interleukin-1beta induces macrophage inflammatory protein-1beta expression in human hepatocytes.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14673550 2004 Independent expression of the two paralogous CCL4 genes in monocytes and B lymphocytes.
14582706 2003 Beta-chemokine, macrophage inflammatory protein-1beta (MIP-1beta), is highly expressed in diffuse type human gastric cancers.
12679478 2003 Expression of macrophage inflammatory protein-1beta in human endometrium: its role in endometrial recruitment of natural killer cells.
12651610 2003 Cathepsin D specifically cleaves the chemokines macrophage inflammatory protein-1 alpha, macrophage inflammatory protein-1 beta, and SLC that are expressed in human breast cancer.
12603824 2003 Interleukin-1beta stimulates macrophage inflammatory protein-1alpha and -1beta expression in human neuronal cells (NT2-N).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445801 2002 The presence of chemokine (MCP-1, MIP-1alpha, MIP-1beta, IP-10, RANTES)-positive cells and chemokine receptor (CCR5, CXCR3)-positive cells in inflamed human gingival tissues.
12427015 2002 Characterization of the role of the N-loop of MIP-1 beta in CCR5 binding.
12411442 2003 The binding surface and affinity of monomeric and dimeric chemokine macrophage inflammatory protein 1 beta for various glycosaminoglycan disaccharides.
12401480 2002 Macrophage inflammatory protein-1.
12393716 2003 Differential chemokine expression profiles in human peripheral blood T lymphocytes: dependence on T-cell coreceptor and calcineurin signaling.
12393595 2002 Marked increase in CC chemokine gene expression in both human and mouse mast cell transcriptomes following Fcepsilon receptor I cross-linking: an interspecies comparison.
12377943 2002 IFN-gamma and IL-12 differentially regulate CC-chemokine secretion and CCR5 expression in human T lymphocytes.
12218153 2002 Activation of monocytic cells through Fc gamma receptors induces the expression of macrophage-inflammatory protein (MIP)-1 alpha, MIP-1 beta, and RANTES.
12200385 2002 Role for macrophage inflammatory protein (MIP)-1alpha and MIP-1beta in the development of osteolytic lesions in multiple myeloma.
12070155 2002 Natural truncation of the chemokine MIP-1 beta /CCL4 affects receptor specificity but not anti-HIV-1 activity.
12036855 2002 Cholesterol is essential for macrophage inflammatory protein 1 beta binding and conformational integrity of CC chemokine receptor 5.
11751963 2002 Native HIV-1 Tat protein targets monocyte-derived dendritic cells and enhances their maturation, function, and antigen-specific T cell responses.
11685466 2001 The human MIP-1beta chemokine is encoded by two paralogous genes, ACT-2 and LAG-1.
11470920 2001 Perforin-low memory CD8+ cells are the predominant T cells in normal humans that synthesize the beta -chemokine macrophage inflammatory protein-1beta.
11278300 2001 Identification of human macrophage inflammatory proteins 1alpha and 1beta as a native secreted heterodimer.
11129109 2000 No association between presenilin 1 (PS1) intronic polymorphism and sporadic Alzheimer's disease in Koreans.
10985253 2000 HIV-1 Vpr regulates expression of beta chemokines in human primary lymphocytes and macrophages.
10929056 2000 Induction of interactions between CD44 and hyaluronic acid by a short exposure of human T cells to diverse pro-inflammatory mediators.
10900358 2000 Expression of the chemokine receptor CXCR3 on neurons and the elevated expression of its ligand IP-10 in reactive astrocytes: in vitro ERK1/2 activation and role in Alzheimer's disease.
10841574 2000 In vitro correlates of HIV-2-mediated HIV-1 protection.
10751368 2000 Chemokine and chemokine-receptor expression in human glial elements: induction by the HIV protein, Tat, and chemokine autoregulation.
10679098 2000 Lipopolysaccharide inhibits HIV-1 infection of monocyte- derived macrophages through direct and sustained down-regulation of CC chemokine receptor 5.
10608777 2000 Virulent Treponema pallidum, lipoprotein, and synthetic lipopeptides induce CCR5 on human monocytes and enhance their susceptibility to infection by human immunodeficiency virus type 1.
10540332 1999 The assignment of chemokine-chemokine receptor pairs: TARC and MIP-1 beta are not ligands for human CC-chemokine receptor 8.
10395844 1999 Cerebrospinal fluid beta chemokine concentrations in neurocognitively impaired individuals infected with human immunodeficiency virus type 1.
10049593 1999 Chemokine PARC gene (SCYA18) generated by fusion of two MIP-1alpha/LD78alpha-like genes.
9973507 1999 Bacterial superantigens induce down-modulation of CC chemokine responsiveness in human monocytes via an alternative chemokine ligand-independent mechanism.
9743377 1998 CXCR4 and CCR5 on human thymocytes: biological function and role in HIV-1 infection.
9558100 1998 Dendritic cells express multiple chemokine receptors used as coreceptors for HIV entry.
9521068 1998 Identification of the CC chemokines TARC and macrophage inflammatory protein-1 beta as novel functional ligands for the CCR8 receptor.
9520456 1998 Interferon alpha and Tat involvement in the immunosuppression of uninfected T cells and C-C chemokine decline in AIDS.
9405404 1997 Cloning and characterization of a novel promiscuous human beta-chemokine receptor D6.
8699119 1996 Cloning and functional expression of CC CKR5, a human monocyte CC chemokine receptor selective for MIP-1(alpha), MIP-1(beta), and RANTES.
8663314 1996 Molecular cloning and functional characterization of a novel human CC chemokine receptor (CCR5) for RANTES, MIP-1beta, and MIP-1alpha.
8661057 1996 A YAC contig of the human CC chemokine genes clustered on chromosome 17q11.2.
8525373 1995 Identification of RANTES, MIP-1 alpha, and MIP-1 beta as the major HIV-suppressive factors produced by CD8+ T cells.
8134838 1994 High-resolution solution structure of the beta chemokine hMIP-1 beta by multidimensional NMR.
8077676 1994 The chemokines IL-8, monocyte chemoattractant protein-1, and I-309 are monomers at physiologically relevant concentrations.
7622448 1995 Cloning and functional expression of a human eosinophil CC chemokine receptor.
7594543 1995 Molecular characterization of two murine eosinophil beta chemokine receptors.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
7545673 1995 Monocyte chemotactic protein-3 (MCP3) interacts with multiple leukocyte receptors. C-C CKR1, a receptor for macrophage inflammatory protein-1 alpha/Rantes, is also a functional receptor for MCP3.
2809212 1989 A novel polypeptide secreted by activated human T lymphocytes.
2568930 1989 Isolation and characterization of a cDNA encoding a putative cytokine which is induced by stimulation via the CD2 structure on human T lymphocytes.
2521882 1989 Mitogenic activation of human T cells induces two closely related genes which share structural similarities with a new family of secreted factors.
2521353 1989 A family of small inducible proteins secreted by leukocytes are members of a new superfamily that includes leukocyte and fibroblast-derived inflammatory agents, growth factors, and indicators of various activation processes.
2462251 1988 Identification, cloning, and characterization of an immune activation gene.
2247088 1990 Cloning and expression of a lymphocyte activation gene (LAG-1).
1972563 1990 Two inflammatory mediator cytokine genes are closely linked and variably amplified on chromosome 17q.
1894635 1991 The gene encoding the Act-2 cytokine. Genomic structure, HTLV-I/Tax responsiveness of 5' upstream sequences, and chromosomal localization.