Property Summary

NCBI Gene PubMed Count 61
PubMed Score 51.34
PubTator Score 61.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
HIV Infections 94 0.0 0.0
Disease Target Count P-value
psoriasis 6514 1.5e-44
Disease Target Count Z-score Confidence
Acquired immunodeficiency syndrome 192 4.55 2.3
Asymptomatic dengue 2 3.625 1.8

Synonym

Accession P16619 A6NGK6 B2RUX4 Q3B7A8 Q53YA5 Q96I68
Symbols LD78
464.2
MIP1AP
SCYA3L
G0S19-2
SCYA3L1
D17S1718
LD78BETA
LD78-beta(1-70)

Gene

Gene RIF (60)

AA Sequence

MQVSTAALAVLLCTMALCNQVLSAPLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRG      1 - 70
RQVCADPSEEWVQKYVSDLELSA                                                    71 - 93
//

Text Mined References (61)

PMID Year Title