Property Summary

NCBI Gene PubMed Count 37
PubMed Score 130.93
PubTator Score 321.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.541 9.2e-03
cystic fibrosis -1.400 3.3e-04
medulloblastoma -1.100 3.0e-04
tuberculosis and treatment for 6 months 1.300 6.0e-04
invasive ductal carcinoma -1.868 1.5e-02
Breast cancer -5.500 2.9e-34
breast carcinoma -2.000 8.3e-18
ovarian cancer 1.100 1.4e-04
chronic rhinosinusitis 1.457 2.6e-02
facioscapulohumeral dystrophy 1.700 2.1e-02

Gene RIF (22)

PMID Text
26642722 disease severity of atopic dermatitis in children is not correlated to the level of CCL28, but rather related to that of total IgE
25740824 High CCL28 gene methylation is associated with gastric tumor aggressiveness.
25567740 CCL28 was absent in saliva of primary Sjogren's syndrome patients. This finding did not correlate with salivary IgA levels.
24917456 CCL28-CCR3 interactions are involved in the homeostatic trafficking of CD4(+) T cells to the upper airways.
23509159 CCL28 is a potent growth-promoting factor with the ability to support the in vitro and in vivo functional properties of cultured human hematopoietic cells.
21753853 tumour hypoxia promotes the recruitment of regulatory T (T(reg)) cells through induction of expression of the chemokine CC-chemokine ligand 28 (CCL28), which, in turn, promotes tumour tolerance and angiogenesis
21447959 These results indicate a role for IL-17A in the human lung by enhancing the expression of CCL28 and hence driving the recruitment of IgE-secreting B cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19659860 data reinforce concept that CCL28 may contribute to the pathogenesis of atopic dermatitis probably through selective migration & infiltration of effector/memory T-helper-2 cells in the skin; CCL28 may represent a prognostic marker for disease severity
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19003934 There was a robust migration of specific IgA- and IgM-antibody-secreting cells induced by Salmonella vaccination toward the mucosal chemokines CCL25 and CCL28
18426876 These studies are the first to show increased CCL28 production during gastrointestinal infection in humans and provide an explanation for the large influx of IgA-secreting cells to the gastric mucosa in H. pylori-infected individuals.
17912348 CCL28 mediates mucosal immunity in HIV exposure and infection
17703412 Observational study of gene-disease association. (HuGE Navigator)
16785557 Expression of CCL28 by epithelial cells from chronically inflamed liver in response to microbial products or interleukin-1 provides a signal to localize CCR10-expressing regulatory T cells at mucosal surfaces.
16581045 CCL28 is one link between microbial insult and the exacerbation of pathologies such as asthma, through an NFkappaB-dependent mechanism
16433680 CCL28 produced by keratinocytes is mediated by different signal pathways from CCL27, and both CCL27 and CCL28 are involved in the pathogenesis of inflammatory skin diseases.
12671049 CCR10 and its mucosal epithelial ligand CCL28 have roles in the migration of circulating IgA plasmablasts
12538707 CCL28 may play dual roles in mucosal immunity as a chemoattractant for cells expressing CCR10 and/or CCR3 such as plasma cells and also as a broad-spectrum antimicrobial protein secreted into low-salt body fluids.

AA Sequence

MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRR      1 - 70
RICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY                  71 - 127
//

Text Mined References (38)

PMID Year Title
26642722 2015 CCL28 Cannot Replace IgE for Severity by Objective SCORAD Index in Atopic Dermatitis in Children.
25740824 2015 Epigenetic clustering of gastric carcinomas based on DNA methylation profiles at the precancerous stage: its correlation with tumor aggressiveness and patient outcome.
25567740 2015 Absence of salivary CCL28 in primary Sjögren's syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
24917456 2015 A role for CCL28-CCR3 in T-cell homing to the human upper airway mucosa.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23509159 2013 Identification of the chemokine CCL28 as a growth and survival factor for human hematopoietic stem and progenitor cells.
21753853 2011 Tumour hypoxia promotes tolerance and angiogenesis via CCL28 and T(reg) cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21447959 2011 IL-17A induces CCL28, supporting the chemotaxis of IgE-secreting B cells.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19659860 2009 Serum mucosa-associated epithelial chemokine (MEC/CCL28) in atopic dermatitis: a specific marker for severity.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19003934 2008 Human IgA-secreting cells induced by intestinal, but not systemic, immunization respond to CCL25 (TECK) and CCL28 (MEC).
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18426876 2008 CCL28 is increased in human Helicobacter pylori-induced gastritis and mediates recruitment of gastric immunoglobulin A-secreting cells.
18308860 2008 CCL25 and CCL28 promote alpha4 beta7-integrin-dependent adhesion of lymphocytes to MAdCAM-1 under shear flow.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17912348 2007 The mucosae-associated epithelial chemokine (MEC/CCL28) modulates immunity in HIV infection.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16785557 2006 Epithelial inflammation is associated with CCL28 production and the recruitment of regulatory T cells expressing CCR10.
16581045 2005 IL-1beta and TNF-alpha induce increased expression of CCL28 by airway epithelial cells via an NFkappaB-dependent pathway.
16433680 2006 CCL28 production in HaCaT cells was mediated by different signal pathways from CCL27.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
12671049 2003 CCR10 expression is a common feature of circulating and mucosal epithelial tissue IgA Ab-secreting cells.
12538707 2003 CCL28 has dual roles in mucosal immunity as a chemokine with broad-spectrum antimicrobial activity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11825560 2002 Chemokines and the tissue-specific migration of lymphocytes.
11295038 2001 Identification of a novel beta-chemokine, MEC, down-regulated in primary breast tumors.
10975800 2000 A novel chemokine ligand for CCR10 and CCR3 expressed by epithelial cells in mucosal tissues.
10781587 2000 Identification of a novel chemokine (CCL28), which binds CCR10 (GPR2).
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.