Property Summary

NCBI Gene PubMed Count 76
PubMed Score 563.49
PubTator Score 217.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
uncontrolled asthma 1.600 4.0e-03
Atopic dermatitis 2.300 7.1e-05
pituitary cancer -1.900 7.3e-05

Gene RIF (65)

PMID Text
26116899 HIV-1 Vpr upregulates the gene expression of CCL26 in human monocyte-derived dendritic cells
25936567 These results show a relation between CCL26 production by IL-13-stimulated bronchial epithelial cells , sputum eosinophil counts, and asthma severity. They also suggest a role for CCL26 in the sustained inflammation observed in patients with severe eosinophilic asthma and reveal CCL26 as a potential target for treating patients with eosinophilic asthma that are refractory
25323950 The most potent inhibition of RANTES, eotaxin and eotaxin3 as well as MMP9 activity.
24989688 these data suggest that CCL26 and CCL24 are likely involved in the pathogenesis of chronic nasal hypereosinophilia, with a complex cooperation and different involvement of the various members of eotaxin family.
24684589 These findings indicate that eotaxin-3 is expressed in Chronic subdural hematoma fluid
24600981 CCL11, CCL24, and CCL26 are increased in TB patients; hence, it seems that TB suppresses Th1 and the classic function of macrophages subsequently by inducing the chemokines' expression
24323578 these data identify a contributory role for DNA methylation in regulating eotaxin-3 production in human allergic inflammation.
23607908 elevated expression in the active lesions of ulcerative colitis and Crohn's disease
23532518 CCL26 is a more effective chemoattractant than CCL11 or CCL24 for eosinophils of asthmatics. All eotaxins induced the eosinophil migration from 0 to 6 h, but CCL26 triggered a second phase of migration between 12 & 18 h.
23477905 CCL11, CCL24, and CCL26 has a role in the recruitment of extravillous trophoblast into decidual tissue and vessels.
23185525 PPIs, in concentrations achieved in blood with conventional dosing, significantly inhibit IL-4-stimulated eotaxin-3 expression in EoE esophageal cells and block STAT6 binding to the promoter.
22952702 Leukotriene D4 and interleukin-13 cooperate to increase the release of eotaxin-3 by airway epithelial cells
22948508 CCL1, CCL26, and IgE may be associated with pruritus in cutaneous T-cell lymphoma.
22946025 Phosphodiesterase 4 inhibitors, rolipram and RO-20-1724 have no effect on CCL26 expression in human primary bronchial epithelial cells.
22846146 The level of eotaxin expression and inflammatory cell count were measured in the material from nasal brushing in healthy controls and in patients with allergic rhinitis, asthma, and chronic obstructive pulmonary disease.
22739041 Up-regulation of CCL2, CCL26, IL6 and LOXL2 genes in cancer cells are part of the common effects of cancer-associated fibroblasts on hepatocellular carcinoma cells
22580413 Oesophageal squamous cells from gastro-oesophageal reflux disease and Eosinophilic oesophagitis patients express similar levels of eotaxin-3 when stimulated by Th2 cytokines, and omeprazole blocks that eotaxin-3 expression.
22226123 Data show that that IL-4 signals through the Jak1, 2/Stat6 pathway in keratinocytes to stimulate CCL26 expression and this may provide an explanation for the pathogenesis of atopic dermatitis (AD).
21985360 these data link the up-regulation of the eosinophil chemotactic factor CCL26 in bullous pemphigoid to the lesional accumulation of activated eosinophils in the skin.
21881593 CCL26 but not CCL24 was elevated in bullous pemphigoid lesions.
21493274 The expression of AMCase, eotaxin-3, IL-13, and mRNA was significantly higher in patients with CRSwNP than in the control group.
21325281 Epigenetic regulation of the IL-13-induced human eotaxin-3 gene by CREB-binding protein-mediated histone 3 acetylation.
21303604 AMCase and eotaxin-3 may be important mediators in the pathogenesis of nasal polyps. The increased AMCase and eotaxin-3 might lead to nasal polyp formation and growth.
21266446 Serum eotaxin-3 is a sensitive and specific marker for the diagnosis of active Churg-Strauss syndrome suitable for routine clinical practice.
21077277 Serum CCL11 was increased in ulcerative colitis (UC) and less in Crohn's disease (CD), whereas CCL24 and CCL26 were increased only in UC. Colon expression of the CCL's was higher in UC vs. CD, and was induced by Th2 cytokines in colon epithelial cells.
20974991 CCL26 is an agonist for CX3CR1 and may play a dual role in allergic diseases by attracting eosinophils via CCR3 and killer lymphocytes and resident monocytes via chemokine receptor CX3CR1.
20505746 interaction of eotaxins and CCR3 regulates the Th2-dominant tumor environment, which is closely related to the development of cutaneous T-cell lymphoma
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20236835 The mean gene expression level for CCL11, CCL24, CCL26 was higher in skin changes of atopic dermatitis patients than in uninvolved skin.
20143648 promotes lung fibroblast migration
20059579 data show that IL-4 and pro-inflammatory cytokines such as TNF-alpha, IL-1beta and IFN-gamma regulate CCL26 synthesis in human monocytic cells
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19567623 We did not replicate the association of eotaxin-3 with rheumatoid arthrits described in Koreans, or that of the MHC2T single nucleotide polymorphism in Spanish patients
19423540 Observational study of gene-disease association. (HuGE Navigator)
19379605 The abundant biopolymer chitin appears to be recognized by a yet uncharacterized receptor on sinonasal epithelial cells. Chitin stimulates production of AMCase and eotaxin-3, two pro-Th2 effector proteins.
19331716 overexpressed in eosinophilic esophagitis, expression level correlates with disease severity
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19203252 CCL26-directed small-interfering RNA (siRNA) treatments significantly decreased release of CCL5 (RANTES), CCL15 (MIP-1delta), CCL8 (MCP-2), and CCL13 (MCP-4).
19141349 is the most strongly up-regulated gene of the transcriptom in eosinophilic esophagitis patients
19141347 increased levels in patients with eosinophilic esophagitis
18844613 Eotaxin-3/CCL26 gene expression levels were significantly increased in EE. Although they were significantly downregulated upon steroid treatment, control expression levels were not reached in any of the cases analyzed.
18774776 This study demonstrated upregulation of type 1 IL-4R by IFN-gamma, which resulted in enhanced IL-4-induced production of CCL26 from keratinocytes.
18712274 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18055844 Developing lung expresses the eotaxins and functional CCR3 receptor.
17900656 Determination of eotaxin-3 levels by real-time polymerase chain reaction on paraffinized, formalin-fixed tissue may be a useful test in the differentiation of eosinophilic esophagitis from gastroesophageal reflux disease
17703412 Observational study of gene-disease association. (HuGE Navigator)
17541284 The Th2 cytokine IL-4 preferentially stimulated eotaxin-3 expression.
17490641 Data suggest atherosclerotic inflammation may be a trigger for sclerosis in calcified stenotic aortic valves through upregulation TGF-beta, VAP-1, MIG and Eotaxin3, which is only partially inhibited by previous statin therapy.
17073866 Contributes to dermal and epidermal eosinophil infiltration in Th2-polarized skin inflammation in which interleukin-4 is produced.
16604488 Observational study of gene-disease association. (HuGE Navigator)
16453027 results implicate eotaxin-3 as a critical effector molecule for eosinophilic esophagitis and provide insight into disease pathogenesis
16391516 Observational study of gene-disease association. (HuGE Navigator)
16391516 association of eotaxin-3 polymorphisms in ulcerative colitis in Korean patients
16264039 In conclusion, these results suggest that viral airway infection may enhance interleukin-4-induced eotaxin-3 production through upregulation of the interleukin-4 receptor in airway epithelial cells.
16084752 results demonstrate that epithelial eotaxin-3 is up-regulated in the context of a T helper 2 mediated inflammatory bowel disease via the signal transducer and activator of transcription 6
15863444 CCL26 is major eotaxin synthesized and released by alveolar epithelial cells and is involved in autoregulation of CCR3 receptors and other eotaxins. This CCL26-CCR3 ligand-receptor system may be an attractive target in therapy of airway inflammation.
15784470 Observational study of gene-disease association. (HuGE Navigator)
15521376 results suggest that types 1 and 2 IL-4 receptors and nuclear factor-kappaB may have a role in eotaxin-3 production in bronchial epithelial cells
15207712 Observational study of gene-disease association. (HuGE Navigator)
15039444 eotaxin-3 is the first human chemokine that features broadband antagonistic activities; may have a modulatory rather than an inflammatory function;may play an unrecognized role in the polarization of cellular recruitment by attracting Th2 lymphocytes
12689946 eotaxin-3 inhibits MCP-1-mediated responses, thus acting as a natural antagonist for CCR2, and promotes active movement of monocytes away from a gradient of eotaxin-3
12192108 Pretreatment or co-treatment with each of the eotaxins augmented PMAtate-induced superoxide generation, concentration-dependent degranulation of eosinophil peroxidase, & potentiation of A23187-induced degranulation.
12061839 Expression is modulated by cytokines and glucocorticoids.

AA Sequence

MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGK      1 - 70
KVCTHPRKKWVQKYISLLKTPKQL                                                   71 - 94
//

Text Mined References (76)

PMID Year Title
25936567 2015 Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma.
25323950 2014 Inhibitory activity of Socheongryong?tang and its constituent components against the production of RANTES, eotaxin, eotaxin?3 and MMP?9 from BEAS?2B cells.
24989688 2014 Nasal fluid release of eotaxin-3 and eotaxin-2 in persistent sinonasal eosinophilic inflammation.
24684589 2014 Eotaxin-3 activates the Smad pathway through the transforming growth factor beta 1 in chronic subdural hematoma outer membranes.
24600981 2014 All eotaxins CCL11, CCL24 and CCL26 are increased but to various extents in pulmonary tuberculosis patients.
24323578 2014 Demethylation of the human eotaxin-3 gene promoter leads to the elevated expression of eotaxin-3.
23607908 2013 Regulation of eotaxin-3/CC chemokine ligand 26 expression by T helper type 2 cytokines in human colonic myofibroblasts.
23532518 2013 CCL26/eotaxin-3 is more effective to induce the migration of eosinophils of asthmatics than CCL11/eotaxin-1 and CCL24/eotaxin-2.
23477905 2013 Control of extravillous trophoblast function by the eotaxins CCL11, CCL24 and CCL26.
23185525 2012 Omeprazole blocks STAT6 binding to the eotaxin-3 promoter in eosinophilic esophagitis cells.
22952702 2012 Leukotriene D4 and interleukin-13 cooperate to increase the release of eotaxin-3 by airway epithelial cells.
22948508 2013 Association of nerve growth factor, chemokine (C-C motif) ligands and immunoglobulin E with pruritus in cutaneous T-cell lymphoma.
22946025 2012 PDE4 inhibitors have no effect on eotaxin expression in human primary bronchial epithelial cells.
22846146 2012 Expression of eotaxins in the material from nasal brushing in asthma, allergic rhinitis and COPD patients.
22739041 2012 Cancer-associated fibroblasts up-regulate CCL2, CCL26, IL6 and LOXL2 genes related to promotion of cancer progression in hepatocellular carcinoma cells.
22580413 2013 Omeprazole blocks eotaxin-3 expression by oesophageal squamous cells from patients with eosinophilic oesophagitis and GORD.
22226123 2012 IL-4 regulates chemokine CCL26 in keratinocytes through the Jak1, 2/Stat6 signal transduction pathway: Implication for atopic dermatitis.
21985360 2011 Up-regulation of CCL11 and CCL26 is associated with activated eosinophils in bullous pemphigoid.
21881593 2012 High levels of CCL26 in blister fluid and sera of patients with bullous pemphigoid.
21493274 2011 Role of eotaxin-3 in chronic rhinosinusitis with nasal polyps.
21325281 2011 Epigenetic regulation of the IL-13-induced human eotaxin-3 gene by CREB-binding protein-mediated histone 3 acetylation.
21303604 2011 Expression and role of acidic mammalian chitinase and eotaxin-3 in chronic rhinosinusitis with nasal polyps.
21266446 2011 Eotaxin-3 in Churg-Strauss syndrome: a clinical and immunogenetic study.
21077277 2010 Increased expression of chemokine receptor CCR3 and its ligands in ulcerative colitis: the role of colonic epithelial cells in in vitro studies.
20974991 2010 Eotaxin-3/CC chemokine ligand 26 is a functional ligand for CX3CR1.
20505746 2010 Eotaxins and CCR3 interaction regulates the Th2 environment of cutaneous T-cell lymphoma.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20236835 2010 Analysis of eotaxin 1/CCL11, eotaxin 2/CCL24 and eotaxin 3/CCL26 expression in lesional and non-lesional skin of patients with atopic dermatitis.
20143648 2010 Eotaxin-2/CCL24 and eotaxin-3/CCL26 exert differential profibrogenic effects on human lung fibroblasts.
20059579 2010 Regulation of eotaxin-3/CCL26 expression in human monocytic cells.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19567623 2009 Lack of association with rheumatoid arthritis of selected polymorphisms in 4 candidate genes: CFH, CD209, eotaxin-3, and MHC2TA.
19525930 2009 CCR3 is a target for age-related macular degeneration diagnosis and therapy.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19379605 Chitin stimulates expression of acidic mammalian chitinase and eotaxin-3 by human sinonasal epithelial cells in vitro.
19331716 Eosinophilic gastrointestinal disorders.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19203252 2009 CCL26-targeted siRNA treatment of alveolar type II cells decreases expression of CCR3-binding chemokines and reduces eosinophil migration: implications in asthma therapy.
19141349 2009 Chemotactic factors associated with eosinophilic gastrointestinal diseases.
19141347 2009 Biomarkers for nononcologic gastrointestinal diseases.
18844613 2008 Treatment with topical steroids downregulates IL-5, eotaxin-1/CCL11, and eotaxin-3/CCL26 gene expression in eosinophilic esophagitis.
18774776 2008 Enhanced CCL26 production by IL-4 through IFN-gamma-induced upregulation of type 1 IL-4 receptor in keratinocytes.
18712274 2008 Genetic interactions model among Eotaxin gene polymorphisms in asthma.
18055844 2008 Ontogeny of the eotaxins in human lung.
17900656 2007 Increased expression of eotaxin-3 distinguishes between eosinophilic esophagitis and gastroesophageal reflux disease.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17541284 2007 Differential regulation of chemokine expression by Th1 and Th2 cytokines and mechanisms of eotaxin/CCL-11 expression in human airway smooth muscle cells.
17490641 2007 VAP-1, Eotaxin3 and MIG as potential atherosclerotic triggers of severe calcified and stenotic human aortic valves: effects of statins.
17073866 2006 Regulatory mechanisms of galectin-9 and eotaxin-3 synthesis in epidermal keratinocytes: possible involvement of galectin-9 in dermal eosinophilia of Th1-polarized skin inflammation.
16604488 2006 [The research on the correlation between eotaxin-3 gene polymorphisms and allergic asthma].
16453027 2006 Eotaxin-3 and a uniquely conserved gene-expression profile in eosinophilic esophagitis.
16391516 2005 The association of eotaxin-2 and eotaxin-3 gene polymorphisms in a Korean population with ulcerative colitis.
16264039 2005 dsRNA enhances eotaxin-3 production through interleukin-4 receptor upregulation in airway epithelial cells.
16084752 2005 Eotaxin-3/CCL26 gene expression in intestinal epithelial cells is up-regulated by interleukin-4 and interleukin-13 via the signal transducer and activator of transcription 6.
15863444 2005 Autoregulation of CCL26 synthesis and secretion in A549 cells: a possible mechanism by which alveolar epithelial cells modulate airway inflammation.
15784470 2005 Eotaxin-3 gene polymorphisms are associated with rheumatoid arthritis in a Korean population.
15521376 2004 Regulatory mechanisms of Th2 cytokine-induced eotaxin-3 production in bronchial epithelial cells: possible role of interleukin 4 receptor and nuclear factor-kappaB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15207712 2004 Analysis of the polymorphisms in eotaxin gene family and their association with asthma, IgE, and eosinophil.
15039444 2004 Eotaxin-3/CCL26 is a natural antagonist for CC chemokine receptors 1 and 5. A human chemokine with a regulatory role.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12853948 2003 The DNA sequence of human chromosome 7.
12689946 2003 Eotaxin-3 is a natural antagonist for CCR2 and exerts a repulsive effect on human monocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12192108 2002 Regulatory effects of eotaxin, eotaxin-2, and eotaxin-3 on eosinophil degranulation and superoxide anion generation.
12061839 2002 Regulation of human eotaxin-3/CCL26 expression: modulation by cytokines and glucocorticoids.
11748272 2001 Shear-dependent eosinophil transmigration on interleukin 4-stimulated endothelial cells: a role for endothelium-associated eotaxin-3.
11544308 2001 Activation of eotaxin-3/CCLl26 gene expression in human dermal fibroblasts is mediated by STAT6.
11425309 2001 NMR solution structure and backbone dynamics of the CC chemokine eotaxin-3.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10488147 1999 Molecular cloning of a novel human CC chemokine (Eotaxin-3) that is a functional ligand of CC chemokine receptor 3.
10415065 1999 A novel human CC chemokine, eotaxin-3, which is expressed in IL-4-stimulated vascular endothelial cells, exhibits potent activity toward eosinophils.
10373330 1999 Molecular cloning and characterization of a novel human CC chemokine, SCYA26.
9847074 1998 Toward a complete human genome sequence.