Property Summary

NCBI Gene PubMed Count 38
PubMed Score 57.43
PubTator Score 68.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 1.9e-03
medulloblastoma, large-cell 2.000 1.5e-04
adult high grade glioma 1.100 5.5e-03
ovarian cancer 1.400 4.1e-07

Gene RIF (20)

PMID Text
26879872 Studies indicate important roles played by chemokine ligand 25 (CCL25)/chemokine receptor 9 (CCR9) in tumorigenesis, tumor chemoresistance and metastasis.
26472015 CpG methylation is reduced in gingival biopsies of patients with periodontitis
26279399 CCL25 mRNA and protein levels were significantly increased in the nasopharyngeal carcinoma group compared with the control group.
25691296 CCR9-CCL25 interaction promoted proliferation and suppressed apoptosis of non-small cell lung cancer cells by activating the PI3K/Akt pathway.
25296976 Expression of CCR9 and CCL25, the only natural ligand of CCR9, was significantly higher (p<0.0001) in NSCLC tissues and serum respectively, compared to their respective controls.
25275597 TECK derived from endometrial stromal cell and macrophages upregulates the number and function of Tregs in the ectopic milieu.
24936795 High CCL25 expression is associated with the pathogenesis of ulcerative colitis.
22863617 CCL25 and CCR9 regulate colorectal cancer progression and invasion.
22102554 cell migration assays revealed that mesenchymal stromal cells (MSCs) have tropism toward multiple myeloma (MM) cells, and CCL25 was identified as a major MM cell-produced chemoattractant for MSCs.
21637913 We provide the first evidence that CCR9 and its natural ligand CCL25 are highly expressed by ovarian cancer tissue and their expression correlates with histological subtypes.
21344163 CCL25 enhanced the expression of MMP-1, -9, -11 and -13 active proteins by BrCa cells in a CCR9-dependent fashion.
20738854 CCL25 may be involved in the differentiation of monocytes to macrophages particularly in rheumatoid arthritis
20081876 over-expressed TECK interacts with CCR9 on the endometrial stromal cells in the endometriotic milieu, which may contribute to the onset and progression of endometriosis.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19003934 There was a robust migration of specific IgA- and IgM-antibody-secreting cells induced by Salmonella vaccination toward the mucosal chemokines CCL25 and CCL28
18245522 High expression may explain high incidence of melanoma metastis to the small intestine.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17510295 Intracellular signaling required for CCL25-stimulated T cell adhesion mediated by the integrin alpha4beta1.
16517733 demonstrate a unique pattern of regulation for CCL25 and suggest a role for caudal type homeo box proteins in regulating CCL25 transcription
12949249 CCL25 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus.

AA Sequence

MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKR      1 - 70
HRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNV     71 - 140
SLLISANSGL                                                                141 - 150
//

Text Mined References (41)

PMID Year Title
26879872 2016 CCR9 in cancer: oncogenic role and therapeutic targeting.
26472015 2016 Epigenetic characteristics in inflammatory candidate genes in aggressive periodontitis.
26279399 2015 Intracellular expression profile and clinical significance of the CCR9-CCL25 chemokine receptor complex in nasopharyngeal carcinoma.
25691296 2015 CCR9-CCL25 interaction suppresses apoptosis of lung cancer cells by activating the PI3K/Akt pathway.
25296976 2014 CCR9/CCL25 expression in non-small cell lung cancer correlates with aggressive disease and mediates key steps of metastasis.
25275597 2014 CD4+Foxp3+ regulatory T cell differentiation mediated by endometrial stromal cell-derived TECK promotes the growth and invasion of endometriotic lesions.
24936795 2014 CCL25/CCR9 interactions regulate the function of iNKT cells in oxazolone-induced colitis in mice.
23341447 2013 ?-Arrestin recruitment and G protein signaling by the atypical human chemokine decoy receptor CCX-CKR.
22863617 2012 Chemokine 25-induced signaling suppresses colon cancer invasion and metastasis.
22102554 2012 Bone marrow-derived mesenchymal stromal cells are attracted by multiple myeloma cell-produced chemokine CCL25 and favor myeloma cell growth in vitro and in vivo.
21637913 2011 Expression and histopathological correlation of CCR9 and CCL25 in ovarian cancer.
21344163 2011 CCL25 mediates migration, invasion and matrix metalloproteinase expression by breast cancer cells in a CCR9-dependent fashion.
20738854 2010 Monocytes/macrophages express chemokine receptor CCR9 in rheumatoid arthritis and CCL25 stimulates their differentiation.
20081876 2010 Abnormal regulation of chemokine TECK and its receptor CCR9 in the endometriotic milieu is involved in pathogenesis of endometriosis by way of enhancing invasiveness of endometrial stromal cells.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19003934 2008 Human IgA-secreting cells induced by intestinal, but not systemic, immunization respond to CCL25 (TECK) and CCL28 (MEC).
18308860 2008 CCL25 and CCL28 promote alpha4 beta7-integrin-dependent adhesion of lymphocytes to MAdCAM-1 under shear flow.
18245522 2008 Activation of CCR9/CCL25 in cutaneous melanoma mediates preferential metastasis to the small intestine.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17510295 2007 Intracellular signaling required for CCL25-stimulated T cell adhesion mediated by the integrin alpha4beta1.
16517733 2006 Functional characterization of the CCL25 promoter in small intestinal epithelial cells suggests a regulatory role for caudal-related homeobox (Cdx) transcription factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12671049 2003 CCR10 expression is a common feature of circulating and mucosal epithelial tissue IgA Ab-secreting cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11825560 2002 Chemokines and the tissue-specific migration of lymphocytes.
11805153 2002 The intestinal chemokine thymus-expressed chemokine (CCL25) attracts IgA antibody-secreting cells.
11238115 2001 Human thymus contains 2 distinct dendritic cell populations.
11046037 2000 The role of thymus-expressed chemokine and its receptor CCR9 on lymphocytes in the regional specialization of the mucosal immune system.
10974041 2000 Lymphocyte CC chemokine receptor 9 and epithelial thymus-expressed chemokine (TECK) expression distinguish the small intestinal immune compartment: Epithelial expression of tissue-specific chemokines as an organizing principle in regional immunity.
10706668 2000 Cutting edge: identification of a novel chemokine receptor that binds dendritic cell- and T cell-active chemokines including ELC, SLC, and TECK.
10640743 2000 CCR9A and CCR9B: two receptors for the chemokine CCL25/TECK/Ck beta-15 that differ in their sensitivities to ligand.
10544196 1999 Human G protein-coupled receptor GPR-9-6/CC chemokine receptor 9 is selectively expressed on intestinal homing T lymphocytes, mucosal lymphocytes, and thymocytes and is required for thymus-expressed chemokine-mediated chemotaxis.
10498628 1999 TECK, an efficacious chemoattractant for human thymocytes, uses GPR-9-6/CCR9 as a specific receptor.
10229797 1999 Cutting edge: identification of the orphan chemokine receptor GPR-9-6 as CCR9, the receptor for the chemokine TECK.
9722960 1998 The human CC chemokine TECK (SCYA25) maps to chromosome 19p13.2.
9285413 1997 TECK: a novel CC chemokine specifically expressed by thymic dendritic cells and potentially involved in T cell development.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.