Property Summary

NCBI Gene PubMed Count 54
PubMed Score 83.72
PubTator Score 73.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis and treatment for 3 months -1.500 1.6e-07
active Crohn's disease 1.446 1.8e-03
interstitial cystitis 1.100 7.2e-04
ulcerative colitis 1.300 3.6e-04

 GO Component (1)

Gene RIF (41)

PMID Text
25774667 HMGB1 did not elicit chemotaxis of human eosinophils alone and had no effect in combination with the eosinophil chemotactic agent, eotaxin-2 (CCL24).
24989688 these data suggest that CCL26 and CCL24 are likely involved in the pathogenesis of chronic nasal hypereosinophilia, with a complex cooperation and different involvement of the various members of eotaxin family.
24600981 CCL11, CCL24, and CCL26 are increased in TB patients; hence, it seems that TB suppresses Th1 and the classic function of macrophages subsequently by inducing the chemokines' expression
23696919 Pregnancy associated environments increased local CCL24/CCR3, supporting the process of decidualization in human early pregnancy.
23477905 CCL11, CCL24, and CCL26 has a role in the recruitment of extravillous trophoblast into decidual tissue and vessels.
23025269 Study shows that CCL24 levels were significantly increased in age-related macular degeneration (AMD) patients despite Avastin treatment as compared with normal controls and those without Avastin.
22946025 Phosphodiesterase 4 inhibitors, rolipram and RO-20-1724 have no effect on CCL24 expression in human primary bronchial epithelial cells.
22846146 The level of eotaxin expression and inflammatory cell count were measured in the material from nasal brushing in healthy controls and in patients with allergic rhinitis, asthma, and chronic obstructive pulmonary disease.
21077277 Serum CCL11 was increased in ulcerative colitis (UC) and less in Crohn's disease (CD), whereas CCL24 and CCL26 were increased only in UC. Colon expression of the CCL's was higher in UC vs. CD, and was induced by Th2 cytokines in colon epithelial cells.
20659406 CCR3 is differentially expressed on inflammatory cells in rheumatoid arthritis, while eotaxin-2, a potent CCR3 agonist, is differentially expressed in active disease.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20236835 The mean gene expression level for CCL11, CCL24, CCL26 was higher in skin changes of atopic dermatitis patients than in uninvolved skin.
20143648 stimulates lung fibroblast proliferation and collagen synthesis
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19828696 Data show that induction of CCL2 and CCL24 was directly mediated by ligand-activated retinoic acid receptors.
19522186 After corticosteroid therapy, the expressions of Eotaxin and Eotaxin-2 in mucosal epithelia of nasal polyps were significantly decreased.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19264973 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
18712274 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18055844 Developing lung expresses the eotaxins and functional CCR3 receptor.
17917245 the ability to produce eotaxin-2/CCL24 is acquired during the differentiation into eosinophilic lineage which is dependent on GATA-1 expression
17908961 eotaxin-2 is a chemokine strongly associated with primary and metastatic tumors of colorectal origin
17703412 Observational study of gene-disease association. (HuGE Navigator)
17630924 These data support the idea that CCL24/eotaxin-2 is part of the mechanism of CD4 lymphocyte activation paracrinally induced by Nef.
17630924 Treatment of human primary monocyte-derived macrophages with HIV-1 Nef upregulates expression and release of CCL24/eotaxin-2
17438849 The expression of Eotaxin-1 and -2 in nasal polyposis and polyps was dramatically higher than in controls.
16391516 Observational study of gene-disease association. (HuGE Navigator)
16391516 Our results suggest that Eo2 +179T>C and Eo2 +275C>T of eotaxin-2 might be associated with the susceptibility of ulcerative colitis.
16304252 Plasma eotaxin-2 concentrations differed in asthmatic patients with respect to aspirin intolerance and tolerance, indicating that eotaxin-2 may be differentially up-regulated according to aspirin intolerance.
15744457 Observational study of gene-disease association. (HuGE Navigator)
15580493 Observational study of gene-disease association. (HuGE Navigator)
15207712 Observational study of gene-disease association. (HuGE Navigator)
12193745 Intradermal injection of CCL24 induces recruitment of eosinophils, basophils, neutrophils, and macrophages as well as features of early- and late-phase allergic reactions in atopic and nonatopic volunteers.
12192108 Pretreatment or co-treatment with each of the eotaxins augmented PMAtate-induced superoxide generation, concentration-dependent degranulation of eosinophil peroxidase, & potentiation of A23187-induced degranulation.
12034562 alters eosinophil integrin function via mitogen-activated protein kinases
11467997 This protein is an eosinophil chemoattractant that is up-regulated by human rhinovirus infection in cultured bronchial epithelial cells.

AA Sequence

MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKG      1 - 70
QQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC                          71 - 119
//

Text Mined References (55)

PMID Year Title
25774667 2015 Physiologic concentrations of HMGB1 have no impact on cytokine-mediated eosinophil survival or chemotaxis in response to Eotaxin-2 (CCL24).
24989688 2014 Nasal fluid release of eotaxin-3 and eotaxin-2 in persistent sinonasal eosinophilic inflammation.
24600981 2014 All eotaxins CCL11, CCL24 and CCL26 are increased but to various extents in pulmonary tuberculosis patients.
23696919 2013 Trophoblasts-derived chemokine CCL24 promotes the proliferation, growth and apoptosis of decidual stromal cells in human early pregnancy.
23477905 2013 Control of extravillous trophoblast function by the eotaxins CCL11, CCL24 and CCL26.
23025269 2012 New biomarker for neovascular age-related macular degeneration: eotaxin-2.
22946025 2012 PDE4 inhibitors have no effect on eotaxin expression in human primary bronchial epithelial cells.
22846146 2012 Expression of eotaxins in the material from nasal brushing in asthma, allergic rhinitis and COPD patients.
21077277 2010 Increased expression of chemokine receptor CCR3 and its ligands in ulcerative colitis: the role of colonic epithelial cells in in vitro studies.
20659406 Decreased levels of CCR3 in CD4+ lymphocytes of rheumatoid arthritis patients.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20236835 2010 Analysis of eotaxin 1/CCL11, eotaxin 2/CCL24 and eotaxin 3/CCL26 expression in lesional and non-lesional skin of patients with atopic dermatitis.
20143648 2010 Eotaxin-2/CCL24 and eotaxin-3/CCL26 exert differential profibrogenic effects on human lung fibroblasts.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19828696 2009 Chemokine induction by all-trans retinoic acid and arsenic trioxide in acute promyelocytic leukemia: triggering the differentiation syndrome.
19525930 2009 CCR3 is a target for age-related macular degeneration diagnosis and therapy.
19522186 2009 [Effects of corticosteroid on Eotaxin and Eotaxin-2 in nasal polyps].
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
18712274 2008 Genetic interactions model among Eotaxin gene polymorphisms in asthma.
18055844 2008 Ontogeny of the eotaxins in human lung.
17917245 2007 Production and regulation of eotaxin-2/CCL24 in a differentiated human leukemic cell line, HT93.
17908961 2007 Eotaxin-2 and colorectal cancer: a potential target for immune therapy.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17630924 2007 Microarray analysis reveals CCL24/eotaxin-2 as an effector of the pathogenetic effects induced by HIV-1 Nef.
17438849 2007 [Expression and significance of Eotaxin and Eotaxin-2 in nasal polyposis and nasal polyp tissue].
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16391516 2005 The association of eotaxin-2 and eotaxin-3 gene polymorphisms in a Korean population with ulcerative colitis.
16304252 2005 Comparison of plasma eotaxin family level in aspirin-induced and aspirin-tolerant asthma patients.
15744457 2005 Association of eotaxin-2 gene polymorphisms with plasma eotaxin-2 concentration.
15580493 2005 The suggestive association of eotaxin-2 and eotaxin-3 gene polymorphisms in Korean population with allergic rhinitis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15207712 2004 Analysis of the polymorphisms in eotaxin gene family and their association with asthma, IgE, and eosinophil.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218106 2002 Expression of a functional eotaxin (CC chemokine ligand 11) receptor CCR3 by human dendritic cells.
12193745 2002 Eotaxin (CCL11) and eotaxin-2 (CCL24) induce recruitment of eosinophils, basophils, neutrophils, and macrophages as well as features of early- and late-phase allergic reactions following cutaneous injection in human atopic and nonatopic volunteers.
12192108 2002 Regulatory effects of eotaxin, eotaxin-2, and eotaxin-3 on eosinophil degranulation and superoxide anion generation.
11286614 2001 Detection of mRNA for eotaxin-2 and eotaxin-3 in human dermal fibroblasts and their distinct activation profile on human eosinophils.
11141953 2000 [The role of chemokines in nasal polyps].
10913244 2000 NMR solution structure and receptor peptide binding of the CC chemokine eotaxin-2.
10713092 2000 Differential activation of CC chemokine receptors by AOP-RANTES.
10415058 1999 Glucocorticosteroids inhibit mRNA expression for eotaxin, eotaxin-2, and monocyte-chemotactic protein-4 in human airway inflammation with eosinophilia.
10072545 1999 Differential regulation of eosinophil chemokine signaling via CCR3 and non-CCR3 pathways.
9598329 1998 Assignment of the human CC chemokine MPIF-2/eotaxin-2 (SCYA24) to chromosome 7q11.23.
9365122 1997 Cloning and functional characterization of a novel human CC chemokine that binds to the CCR3 receptor and activates human eosinophils.
9104803 1997 Molecular and functional characterization of two novel human C-C chemokines as inhibitors of two distinct classes of myeloid progenitors.