Property Summary

NCBI Gene PubMed Count 42
PubMed Score 48.75
PubTator Score 44.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (24)

PMID Text
26560043 CCL23 is posttranslationally modified by trypsin-like serine proteases and CCL23(47-117) might be a major active form of CCL23 in nasal polyps with chronic rhinosinusitis.
24995525 The coexistence of diabetes and oxidative stress independently affected CCL23 levels, while the presence of Cardiovascular disease and inflammation had no impact on its concentrations.
24384427 ADAMTS 8, CCL23, and TNFSF15 are implicated in anti-angiogenic activities
21656154 Data show CCL23 stimulates chemotaxis of human THP-1 monocytes and enhances release of MMP-2, and suggest it plays a role in atherogenesis.
21646793 Fresh eosinophils contained trace amounts of CCL23 protein. CCL23 was significantly released into the supernatant when the eosinophils were stimulated with GM-CSF or IL-5 but not with IFN-gamma or immobilized sIgA.
21497884 Overproduction of CCL23 in nasal polyps might contribute to the pathogenesis of eosinophilic chronic rhinosinusitis with nasal polyps
21109018 The role of KLF6 and PPAR-gamma in MIP-3alpha transcriptional regulation, was determined.
20824279 Patients with systemic sclerosis who had elevated CCL23 levels had shorter disease duration, and a higher frequency of pulmonary arterial hypertension. Serum CCL23 level was increased in early phase of disease and could be a marker for disease activity.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20187767 independently associated with coronary atherosclerosis
20097574 CKbeta8- and CKbeta8-1-induced activation of ERK1/2 is mediated by the G(i)/G(o) protein, PLC, and PKCdelta.
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19951712 CKbeta8 transduces the chemotaxis signal through the G(i)/G(o) protein, phospholipase C, protein kinase C delta and NF-kappaB.
19265684 these findings suggest that CCL23 results in up-regulation of KDR/flk-1 receptor gene transcription and protein expression and that KDR/Flk-1 up-regulation induced by CCL23 may contribute to potentiation of VEGF action in angiogenesis.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18668547 CCL23, M-CSF, TNFRSF9, TNF-alpha, and CXCL13 are predictive of rheumatoid arthritis disease activity and may be useful in the definition of disease subphenotypes and in the measurement of response to therapy in clinical studies.
18258606 This protein may participate in the malignant progression of certain human cancer cells that overexpress ErbB2 through the transactivation of ErbB2 tyrosine kinase.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17513790 A peptide ligand termed SHAAGtide is cleaved from CCL23; is itself an attractant of monocytes and neutrophils in vitro; recruits leukocytes in vivo; is more potent than other natural agents with activity for FPRL1; receives authors' designation "CCR12."
17371990 Collectively, these data suggest a link between the inducible phenotype of CCL23 expression in monocytes by the prototype Th2 molecule pair IL-4/STAT6 and the increased number of CCL23-expressing cells in skin of atopic dermatitis patients.
16378600 May play a direct role in angiogenesis via upregulation of matrix metalloproteinase (MMP)-2 expression.
15927850 CCL23 promoted chemotactic migration and differentiation of endothelial cells, and neovascularization in the chick chorioallantoic membrane
2611899 HIV-1 Vpr upregulates the gene expression of CCL23 in human monocyte-derived dendritic cells

AA Sequence

MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTPRSIPCSLLES      1 - 70
YFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCVRMLKLDTRIKTRKN                         71 - 120
//

Text Mined References (43)

PMID Year Title
26560043 2016 Tissue proteases convert CCL23 into potent monocyte chemoattractants in patients with chronic rhinosinusitis.
24995525 2014 Effect of diabetes and oxidative stress on plasma CCL23 levels in patients with severe chronic kidney disease.
24384427 2014 Genome-wide study reveals an important role of spontaneous autoimmunity, cardiomyocyte differentiation defect and anti-angiogenic activities in gender-specific gene expression in Keshan disease.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
22633458 2012 The chemokine superfamily revisited.
22147696 2012 Biochemical analysis of matrix metalloproteinase activation of chemokines CCL15 and CCL23 and increased glycosaminoglycan binding of CCL16.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21656154 2011 Potential involvement of CCL23 in atherosclerotic lesion formation/progression by the enhancement of chemotaxis, adhesion molecule expression, and MMP-2 release from monocytes.
21646793 2011 Human eosinophils produce and release a novel chemokine, CCL23, in vitro.
21497884 2011 Increased expression of the chemokine CCL23 in eosinophilic chronic rhinosinusitis with nasal polyps.
21109018 2011 The roles of Kruppel-like factor 6 and peroxisome proliferator-activated receptor-? in the regulation of macrophage inflammatory protein-3? at early onset of diabetes.
20824279 2011 Serum CCL23 levels are increased in patients with systemic sclerosis.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20187767 2010 Associations of four circulating chemokines with multiple atherosclerosis phenotypes in a large population-based sample: results from the dallas heart study.
20097574 2010 CKbeta8/CCL23 and its isoform CKbeta8-1 induce up-regulation of cyclins via the G(i)/G(o) protein/PLC/PKCdelta/ERK leading to cell-cycle progression.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19951712 2010 CK beta 8/CCL23 induces cell migration via the Gi/Go protein/PLC/PKC delta/NF-kappa B and is involved in inflammatory responses.
19265684 2009 CCL23 up-regulates expression of KDR/Flk-1 and potentiates VEGF-induced proliferation and migration of human endothelial cells.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
18668547 2008 Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor.
18258606 2008 Macrophage inhibitory cytokine-1 activates AKT and ERK-1/2 via the transactivation of ErbB2 in human breast and gastric cancer cells.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17513790 2007 Proinflammatory proteases liberate a discrete high-affinity functional FPRL1 (CCR12) ligand from CCL23.
17371990 2007 CCL23 expression is induced by IL-4 in a STAT6-dependent fashion.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16378600 2006 Human CC chemokine CCL23 enhances expression of matrix metalloproteinase-2 and invasion of vascular endothelial cells.
15927850 2005 Human CC chemokine CCL23, a ligand for CCR1, induces endothelial cell migration and promotes angiogenesis.
15905581 2005 Proteolytic activation of alternative CCR1 ligands in inflammation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11060285 2001 Solution structure and dynamics of myeloid progenitor inhibitory factor-1 (MPIF-1), a novel monomeric CC chemokine.
10737895 2000 CKbeta-8 [CCL23], a novel CC chemokine, is chemotactic for human osteoclast precursors and is expressed in bone tissues.
10660125 2000 Selective binding of the truncated form of the chemokine CKbeta8 (25-99) to CC chemokine receptor 1(CCR1).
10409433 1999 Physical mapping of the CC-chemokine gene cluster on the human 17q11. 2 region.
10213461 1999 Organization of the chemokine gene cluster on human chromosome 17q11.2 containing the genes for CC chemokine MPIF-1, HCC-2, HCC-1, LEC, and RANTES.
9886417 1999 Characterization of the signal transduction pathway activated in human monocytes and dendritic cells by MPIF-1, a specific ligand for CC chemokine receptor 1.
9834116 1998 Identification of a truncated form of the CC chemokine CK beta-8 demonstrating greatly enhanced biological activity.
9558365 1998 Characterization of CKbeta8 and CKbeta8-1: two alternatively spliced forms of human beta-chemokine, chemoattractants for neutrophils, monocytes, and lymphocytes, and potent agonists at CC chemokine receptor 1.
9187369 1997 CKbeta8, a novel CC chemokine that predominantly acts on monocytes.
9129202 1997 The chemokine information source: identification and characterization of novel chemokines using the WorldWideWeb and expressed sequence tag databases.
9104803 1997 Molecular and functional characterization of two novel human C-C chemokines as inhibitors of two distinct classes of myeloid progenitors.
8661057 1996 A YAC contig of the human CC chemokine genes clustered on chromosome 17q11.2.